Recombinant Citrobacter koseri UPF0442 protein CKO_03436 (CKO_03436)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Citrobacter koseri UPF0442 protein CKO_03436 (UniProt ID: A8AM03) is a 157-amino-acid protein expressed in E. coli with an N-terminal His tag. This protein belongs to the UPF0442 family, a conserved group of bacterial proteins implicated in virulence and pathogenicity. Its recombinant form is widely used in biochemical and immunological studies to investigate C. koseri infection mechanisms and host-pathogen interactions .

Association with Virulence Mechanisms

  • Iron Acquisition: CKO_03436 is linked to the High Pathogenicity Island (HPI) gene cluster in C. koseri, which facilitates iron uptake in iron-deficient host environments. This HPI shares homology with pathogenic Yersinia species and is critical for survival in mammalian hosts .

  • Virulence Attenuation: Deletion of the HPI cluster (including CKO_03436 homologs) reduces C. koseri’s ability to colonize the brain and bloodstream in murine models, underscoring its role in virulence .

Functional Annotations

  • Bioinformatics Insights: Comparative genomics identifies CKO_03436 as part of a core genome enriched in transport and metabolism pathways, particularly ABC transporters for amino acids and carbohydrates .

  • Secretory Systems: Unlike other Citrobacter species, C. koseri lacks Type VI secretion systems (T6SS) but compensates through HPI-mediated iron scavenging .

Antibiotic Resistance Studies

  • Target Identification: CKO_03436 is studied alongside other proteins (e.g., DP-3-O-acyl-N-acetylglucosamine deacetylase) to identify novel antibiotic targets, given C. koseri’s resistance to β-lactams, carbapenems, and fluoroquinolones .

  • Drug Discovery: Molecular docking studies prioritize CKO_03436-interacting compounds like CMNPD13085 and CMNPD15632, which show high binding affinity in silico .

Vaccine Development

  • Antigenic Potential: While subtractive proteomics highlights other proteins (e.g., arabinose 5-phosphate isomerase) as vaccine candidates, CKO_03436’s role in iron acquisition makes it a viable target for epitope mapping and antibody development .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CKO_03436; UPF0442 protein CKO_03436
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
CKO_03436
Target Protein Sequence
MGVIDFLLALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGSRMVMMTAGFNIE WSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHFGYSEP LMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV
Uniprot No.

Target Background

Database Links
Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.