Recombinant Citrobacter koseri UPF0761 membrane protein CKO_03126 (CKO_03126)

Shipped with Ice Packs
In Stock

Description

Basic Characteristics of CKO_03126

Recombinant Citrobacter koseri UPF0761 membrane protein CKO_03126 is a full-length, His-tagged protein derived from the Citrobacter koseri UPF0761 gene. Key features include:

PropertyDetails
Protein Length290 amino acids (1–290 aa)
Molecular WeightNot explicitly stated (estimated via sequence analysis)
Source OrganismCitrobacter koseri (Gram-negative bacterium)
Expression SystemE. coli (recombinant production)
TagN-terminal His tag
Purity>90% (SDS-PAGE validated)
FormLyophilized powder
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
UniProt IDA8AL54

Source:

Applications and Research Significance

CKO_03126 is primarily utilized in structural and functional studies of C. koseri membrane biology. Potential applications include:

  • Antibiotic Resistance Studies: Exploring interactions with antimicrobial peptides or β-lactamase inhibitors.

  • Vaccine Development: As a candidate antigen, though not yet prioritized in subtractive proteomics screens .

  • Membrane Protein Structural Analysis: Elucidating folding patterns via X-ray crystallography or cryo-EM.

Comparative Analysis with Related Proteins

Gene and Protein Metadata:

AttributeCKO_03126 (UPF0761)Other C. koseri Proteins
UniProt IDA8AL54A8AD07 (UNG)
Pathway InvolvementUndocumentedNucleotide excision repair
Expression HostE. coliE. coli (common)

Sources:

Challenges and Future Directions

  1. Functional Elucidation: Requires knockout studies or interaction mapping.

  2. Structural Determination: Cryo-EM or NMR studies to resolve membrane topology.

  3. Therapeutic Potential: Testing as a vaccine candidate or drug target.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
CKO_03126; UPF0761 membrane protein CKO_03126
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
CKO_03126
Target Protein Sequence
MLKNVHQKARHHTRPVRAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAA FPMFSDVSLQLRHFIFANFIPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAI DSALNTIWRSKRTRPKVYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASELNTVIDNV LRVFPLILSWISFWLLYSIVPTTRVPNRDAVVGAFVAAVLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEADQS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for producing functional CKO_03126 protein?

E. coli is the established expression system for recombinant CKO_03126 protein production, as demonstrated in existing protocols. The current available recombinant form utilizes an N-terminal His-tag for purification purposes .

For researchers seeking to optimize expression, consider the following methodological approach:

  • Strain selection: BL21(DE3), C41(DE3), or C43(DE3) strains are recommended for membrane protein expression

  • Expression vector optimization: pET series vectors containing T7 promoter systems with tunable induction

  • Induction conditions: Lower temperatures (16-25°C) with reduced IPTG concentrations (0.1-0.5 mM) often yield better results for membrane proteins

  • Growth media supplementation: Addition of glycerol (0.5-1%) can improve membrane protein folding

Researchers should validate protein functionality through activity assays following successful expression and purification.

What are the optimal storage and handling conditions for purified CKO_03126 protein?

The optimal storage conditions for purified CKO_03126 protein involve maintaining protein stability while preventing degradation. The recommended methodology includes:

  • Long-term storage: Store at -20°C/-80°C in appropriate buffer systems

  • Buffer composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Aliquoting strategy: Prepare single-use aliquots to avoid repeated freeze-thaw cycles

  • Reconstitution protocol:

    • Centrifuge vial briefly before opening

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration (50% is standard)

    • Prepare working aliquots and store at 4°C for up to one week

For experimental applications requiring extended stability, researchers should perform pilot studies comparing different stabilizing additives (glycerol, trehalose, sucrose) and evaluate protein integrity by SDS-PAGE at defined time points.

How should researchers optimize membrane protein reconstitution for functional studies of CKO_03126?

For functional studies involving CKO_03126, proper reconstitution into membrane mimetics is critical. The recommended methodological approach includes:

  • Selection of membrane mimetic:

    • Detergent micelles: DDM, LMNG, or Triton X-100 (initial screening)

    • Lipid nanodiscs: DMPC/DMPG mixtures with MSP1D1 scaffold protein

    • Liposomes: E. coli total lipid extract or defined lipid mixtures

  • Reconstitution protocol:

    • Detergent solubilization of purified protein

    • Addition of lipids at appropriate protein:lipid ratios (1:100 to 1:1000 molar ratio)

    • Controlled detergent removal via dialysis or bio-beads

    • Verification of reconstitution by size-exclusion chromatography

  • Functionality assessment:

    • Thermal stability assays (CPM or nanoDSF)

    • Circular dichroism to confirm secondary structure

    • Functional assays based on predicted activity

Researchers should optimize reconstitution conditions through systematic screening of detergents, lipids, and buffer conditions to maintain native-like protein conformation .

What computational methods are recommended for predicting the structure of CKO_03126?

For predicting the structure of membrane proteins like CKO_03126, researchers should employ a comprehensive computational approach that addresses the unique challenges of membrane protein modeling:

  • Selection of appropriate membrane modeling framework:

    • The biologically realistic implicit membrane model (franklin2019/M19) demonstrates superior performance for membrane protein structure prediction compared to traditional models

    • This approach captures the anisotropic structure and water-filled pores characteristic of biological membranes

  • Prediction workflow:

    • Sequence alignment and homology modeling if suitable templates exist

    • Ab initio modeling for regions lacking homology

    • Refinement in a realistic membrane environment

    • Validation through energy minimization and molecular dynamics

  • Evaluation metrics:

    • Native structure discrimination

    • Prediction of insertion energy and orientation in the membrane

    • ΔΔG calculation accuracy

The M19 model has demonstrated improved performance in computational benchmarks against experimental targets including prediction of protein orientations in bilayers and native structure discrimination, making it particularly suitable for proteins like CKO_03126 .

What experimental techniques should be employed to determine the orientation of CKO_03126 in the membrane?

Determining the orientation of CKO_03126 in the membrane requires a multi-faceted experimental approach:

  • Site-directed labeling techniques:

    • Cysteine scanning mutagenesis with subsequent labeling using membrane-impermeable reagents

    • Analysis of accessibility patterns to determine topology

  • Protease protection assays:

    • Limited proteolysis of reconstituted protein in liposomes

    • Identification of protected fragments by mass spectrometry

  • Antibody accessibility studies:

    • Generation of antibodies against specific domains

    • Assessment of binding to intact vs. permeabilized proteoliposomes

  • Computational validation:

    • Use of the M19 membrane model to predict favorable insertion energy

    • Energy landscape mapping of potential orientations

The experimental data can be integrated with computational predictions to generate a consensus model of CKO_03126 orientation. The M19 model has been validated with oligomeric membrane proteins and has successfully predicted favorable insertion energies where other models failed .

How can researchers experimentally determine the function of the uncharacterized CKO_03126 protein?

Determining the function of uncharacterized membrane proteins like CKO_03126 requires a systematic approach combining computational predictions with targeted experiments:

  • Computational functional inference:

    • Sequence-based analysis: BLAST, HMM profiles, and conserved domain search

    • Structural homology: Comparison with structurally characterized proteins

    • Genomic context: Analysis of operon structure and gene neighborhood

  • Experimental validation plan:

    • Transport assays: Reconstitution in liposomes with fluorescent substrates

    • Binding studies: Thermal shift assays with potential ligands

    • Phenotypic analysis: Gene knockout/complementation in Citrobacter koseri

  • Protein-protein interaction studies:

    • Pull-down assays using His-tagged CKO_03126

    • Crosslinking studies in native or reconstituted systems

    • Bacterial two-hybrid or FRET-based interaction assays

Researchers should develop multiple working hypotheses regarding protein function based on computational predictions and systematically test these hypotheses through targeted experimental approaches.

What approaches are recommended for studying potential protein-protein interactions involving CKO_03126?

For studying protein-protein interactions involving membrane proteins like CKO_03126, researchers should employ complementary approaches that address the challenges of membrane protein biochemistry:

  • In vitro methodologies:

    • Affinity purification with tagged CKO_03126 as bait

    • Crosslinking followed by mass spectrometry (XL-MS)

    • Surface plasmon resonance (SPR) with immobilized CKO_03126

    • Microscale thermophoresis (MST) for quantitative binding analysis

  • In vivo approaches:

    • Split reporter systems (BACTH, split-GFP)

    • Proximity labeling methods (BioID, APEX)

    • Co-immunoprecipitation from native membranes

  • Data analysis framework:

    • Filtering of candidates based on subcellular localization

    • Validation through reciprocal pull-downs

    • Functional characterization of identified interactions

When publishing interaction studies, researchers should present data in table format with quantitative metrics (dissociation constants, enrichment factors) and multiple biological replicates to ensure reproducibility.

How can computational design approaches be applied to engineer CKO_03126 variants with enhanced stability or modified function?

Engineering CKO_03126 variants requires sophisticated computational design approaches specifically tailored for membrane proteins:

  • Computational workflow for stability engineering:

    • Structure prediction using the biologically realistic implicit membrane model (M19)

    • Identification of destabilizing regions through in silico alanine scanning

    • Design of stabilizing mutations preserving native-like features

    • Energy evaluation in a membrane environment accounting for:

      • Interfacial aromatic residue positioning

      • Hydrophobic length matching with bilayer thickness

      • Polar pore preservation

  • Function modification strategy:

    • Identification of putative functional residues through evolutionary analysis

    • Targeted library design focusing on these regions

    • In silico screening of variants using molecular dynamics simulations

    • Experimental validation through activity assays

  • Design evaluation metrics:

    • Native sequence recovery analysis

    • Energy landscape comparison to wild-type protein

    • Preservation of membrane protein hallmarks (interfacial aromatics, hydrophobic matching)

The advanced M19 model overcomes critical flaws in previous membrane models by avoiding leucine-rich designs and generating sequences with amino acid distributions closer to native membrane proteins .

What methodological considerations are important when studying the impact of lipid composition on CKO_03126 structure and function?

Investigating lipid-protein interactions for CKO_03126 requires careful methodological considerations:

  • Experimental design for lipid dependence studies:

    • Systematic reconstitution in defined lipid compositions:

      • Variable head groups (PC, PE, PG, PS)

      • Acyl chain lengths and saturation

      • Inclusion of specific lipids (cardiolipin, cholesterol)

    • Careful control of protein:lipid ratios and reconstitution efficiency

  • Analytical techniques:

    • Differential scanning calorimetry to measure thermostability

    • Solid-state NMR to detect specific lipid-protein interactions

    • Molecular dynamics simulations with explicit lipids

    • Fluorescence-based assays for functional assessment

  • Data analysis framework:

    • Construction of lipid dependence profiles

    • Correlation of lipid properties with functional parameters

    • Identification of specific binding sites vs. bulk effects

Researchers should present lipid dependence data in comprehensive tables correlating multiple parameters (acyl chain length, headgroup, bilayer thickness) with functional metrics to identify determinant factors for CKO_03126 activity.

What are the most common challenges in purifying functional CKO_03126 and how can they be addressed?

Membrane protein purification presents unique challenges that researchers working with CKO_03126 should anticipate and address methodically:

ChallengePotential CausesRecommended Solutions
Low expression yieldProtein toxicity, inclusion body formationOptimize expression conditions (lower temperature, reduced inducer); test different E. coli strains (C41, C43); use fusion partners (MBP, SUMO)
Poor solubilizationInadequate detergent selection, insufficient extraction timeScreen detergent panel (DDM, LMNG, CHS combinations); optimize detergent:protein ratio; extend solubilization time at 4°C
Protein instabilityDetergent-induced denaturation, lipid depletionAdd lipids during purification; include stabilizing additives (glycerol, trehalose); minimize purification time
Aggregation during concentrationDetergent concentration effect, protein-protein interactionsUtilize concentration methods that don't concentrate detergent; maintain temperature at 4°C; add specific lipids
Loss of functionDelipidation, cofactor loss, conformational changesSupplement with specific lipids; identify and add essential cofactors; validate function at each purification step

For CKO_03126, researchers should perform small-scale optimization experiments before scaling up, with protein quality assessment through size-exclusion chromatography after each optimization step .

How should researchers approach the validation of predicted CKO_03126 structures?

Validating predicted structures of CKO_03126 requires a comprehensive strategy combining computational and experimental approaches:

  • Computational validation metrics:

    • Energy evaluation in realistic membrane environments

    • Ramachandran plot analysis for backbone conformations

    • Assessment of insertion energy into the bilayer

    • Molecular dynamics stability over extended simulations

  • Experimental validation techniques:

    • Limited proteolysis to confirm domain organization

    • Disulfide crosslinking to validate predicted residue proximities

    • Site-directed spin labeling EPR for distance measurements

    • Mass spectrometry-based protein footprinting

  • Structure-function correlation studies:

    • Site-directed mutagenesis of key predicted structural elements

    • Functional assays to correlate structural features with activity

    • Thermal stability analysis of designed mutations

Researchers should emphasize the importance of using the biologically realistic implicit membrane model (M19) for validation, as it has demonstrated superior performance in discriminating native structures from incorrect models .

What reporting standards should researchers follow when publishing studies involving CKO_03126?

To ensure reproducibility and transparency in research involving CKO_03126, researchers should adhere to the following reporting standards:

  • Materials reporting:

    • Complete sequence information including any tags

    • Expression construct details with vector maps

    • Strain information and growth conditions

    • Detailed purification protocol with buffer compositions

  • Methodological transparency:

    • Step-by-step protocols for key experiments

    • Equipment specifications and settings

    • Statistical analysis methods and sample sizes

    • Raw data availability statement

  • Computational method documentation:

    • Software versions and parameters

    • Model validation metrics

    • Input files and processing scripts

    • Accessibility of computational workflows

When publishing, researchers should include supplementary material with detailed protocols that would enable reproducibility by other laboratories. Additionally, protein samples should be characterized by multiple methods (SDS-PAGE, mass spectrometry, circular dichroism) to confirm identity and quality .

How can researchers design experiments to critically evaluate contradicting data about CKO_03126 function?

When faced with contradictory data regarding CKO_03126 function, researchers should implement a systematic framework for resolution:

  • Methodological comparison analysis:

    • Side-by-side comparison of experimental conditions

    • Identification of critical variables between studies

    • Standardization of protocols to eliminate methodological differences

  • Orthogonal validation approach:

    • Employ multiple independent techniques to assess the same functional property

    • Utilize both in vitro reconstituted systems and in vivo approaches

    • Quantify function using different detection methodologies

  • Collaborative resolution strategy:

    • Direct collaboration with laboratories reporting contradictory results

    • Exchange of materials and protocols

    • Joint publication of consensus findings or structured disagreement

Researchers should present contradictory data transparently, including a comprehensive table comparing methodological differences between studies and their potential impact on results. The experimental design should explicitly address variables that might explain discrepancies in the literature .

What emerging technologies show promise for advancing our understanding of proteins like CKO_03126?

Several cutting-edge technologies offer significant potential for deeper characterization of membrane proteins like CKO_03126:

  • Structural biology advancements:

    • Cryo-electron microscopy for medium to high-resolution structures without crystallization

    • Integrative structural biology combining multiple data sources (NMR, SAXS, crosslinking)

    • Microcrystal electron diffraction (MicroED) for structure determination from nanocrystals

  • Functional analysis innovations:

    • Single-molecule force spectroscopy for conformational dynamics

    • Nanoscale native mass spectrometry for intact membrane protein complexes

    • Advanced microscopy techniques (STORM, PALM) for in situ localization and dynamics

  • Computational method developments:

    • AI-driven structure prediction specifically optimized for membrane proteins

    • Molecular dynamics with polarizable force fields for accurate membrane interactions

    • Quantum mechanics/molecular mechanics approaches for reaction mechanisms

Researchers should consider how these emerging technologies could address specific knowledge gaps regarding CKO_03126, prioritizing approaches that would overcome current methodological limitations .

What are the key unanswered questions about CKO_03126 that warrant further investigation?

Several critical knowledge gaps regarding CKO_03126 should guide future research priorities:

  • Functional role in Citrobacter koseri:

    • Physiological substrate identification

    • Contribution to bacterial pathogenesis or commensalism

    • Regulatory mechanisms controlling expression

  • Structural organization:

    • High-resolution structure determination

    • Conformational dynamics during function

    • Oligomerization state in native membranes

  • Interaction network:

    • Identification of protein partners

    • Lipid interactions and specificity

    • Integration into cellular pathways

  • Evolutionary significance:

    • Conservation across bacterial species

    • Structural homology with characterized proteins

    • Evolutionary pressure and sequence conservation patterns

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.