Recombinant Citrobacter koseri Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Description

Introduction to ZntB and Its Role in Zinc Transport

Zinc transport protein ZntB is a cation-diffusion facilitator (CDF) family member critical for maintaining intracellular zinc homeostasis in bacteria. While its homologs (e.g., CorA) primarily transport magnesium, ZntB evolved to selectively handle zinc ions, balancing essentiality and toxicity . In Citrobacter koseri, ZntB has been engineered as a recombinant protein for structural and functional studies, particularly its role in pathogenicity and antimicrobial resistance .

Transport Mechanism

ZntB mediates Zn²⁺/H⁺ co-transport via a proton gradient, confirmed through liposomal assays and isothermal titration calorimetry (ITC) . Unlike CorA, which functions as a channel, ZntB operates as an active transporter, with conformational changes regulated by pH and metal binding .

Production Overview

The recombinant protein is expressed in E. coli with an N-terminal His tag for purification. Key specifications include:

ParameterValueSource
Protein LengthFull-length (1–327 aa)
Molecular Weight~37 kDa (predicted)
Purity≥85% (SDS-PAGE verified)
Storage BufferTris-based buffer with 50% glycerol, optimized for stability

Functional Validation

Reconstituted ZntB in liposomes demonstrates pH-dependent Zn²⁺ uptake, with activity abolished under neutral conditions . This confirms its role as a proton-coupled importer, contrasting earlier hypotheses of efflux .

Key Insights

  1. Zinc Homeostasis

    • ZntB regulates intracellular Zn²⁺ levels, preventing toxicity during high external concentrations .

    • Downregulated in Cupriavidus metallidurans under Zn²⁺/Cd²⁺/Cu²⁺ exposure, suggesting import-specific regulation .

  2. Structural Distinctions from CorA

    • ZntB retains pentameric symmetry in apo states, unlike CorA’s Mg²⁺-dependent asymmetry .

    • Cytoplasmic domains show conformational flexibility, critical for transport cycle regulation .

  3. Pathogenic Relevance

    • Overexpression in pathogens like Salmonella enhances zinc scavenging, aiding survival in zinc-limited host environments .

Comparison with CorA

PropertyZntBCorA
Ion SpecificityZn²⁺, Cd²⁺Mg²⁺, Co²⁺
Transport ModeProton-coupled importerChannel-like efflux
Conformational ResponseSymmetry retained in apo stateAsymmetry induced by Mg²⁺ depletion

Antimicrobial Targets

ZntB’s role in pathogen zinc acquisition makes it a candidate for zincophore-based therapies, where zinc-chelating agents disrupt bacterial uptake . Inhibitors targeting ZntB’s pore or proton-coupling mechanism could enhance host zinc sequestration strategies .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your desired tag type for preferential development.
Synonyms
zntB; CKO_01415; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Target Names
zntB
Target Protein Sequence
MEAIKGSEVNVPDAVFAWLLDGRGGIKPLENDDIIDSQHPCWLHLNYTHPDSAQWLASTP LLPNSVRDALAGESSRPRVSRMGEGTLITLRCINGSTDERPDQLVAMRVYMDERFIVSTR QRKVLALDEVVSDLQEGTGPSDCGGWLVDVCDALTDHASEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLAWMNDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQESLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGAWH FGFSMFCILLVVLIGGVTLWLHRSKWL
Uniprot No.

Target Background

Function
Mediates zinc ion efflux.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ZntB and what role does it play in bacterial zinc homeostasis?

ZntB is a membrane transport protein belonging to the CorA metal ion transporter (MIT) family that is widespread in Enterobacteriaceae, including Citrobacter koseri. While initially proposed to function in zinc export, recent evidence suggests ZntB primarily mediates zinc uptake stimulated by a pH gradient across the membrane . ZntB functions as part of a sophisticated network of zinc transporters in bacteria that maintain appropriate intracellular zinc concentrations, which is critical since zinc is an essential microelement for all life forms but becomes toxic in excess .

In the broader context of bacterial zinc homeostasis, high-affinity zinc import is accomplished by ATP-binding cassette (ABC) transporters, which rely on extracellular solute-binding proteins (SBPs) like ZnuA to acquire zinc and deliver it to membrane permeases . ZntB appears to be regulated differently than some other zinc transporters, as studies in Cupriavidus metallidurans revealed that ZntB expression was downregulated in the presence of high concentrations of Zn²⁺, Cd²⁺, and Cu²⁺, further supporting its role as an importer rather than an exporter .

How does the structure of Citrobacter koseri ZntB compare to homologues from other bacterial species?

Despite sharing 95% sequence identity with the ZntB homologue from Salmonella enterica, C. koseri ZntB exhibits remarkable structural differences, including a distinct zinc-coordination environment and a closed rather than open conformation . This surprising structural divergence despite high sequence conservation highlights the conformational flexibility inherent to zinc transport proteins.

When compared with structures of another close ZntB homologue from Escherichia coli (85% sequence identity), C. koseri ZntB further demonstrates the surprisingly plastic nature of zinc-binding environments within the ZntB family . This structural plasticity likely plays a functional role in facilitating efficient zinc binding and delivery to membrane permeases.

The structural differences observed among highly similar ZntB proteins suggest that minor sequence variations can significantly impact protein conformation and metal coordination, which may reflect adaptations to specific environmental conditions or regulatory mechanisms in different bacterial species.

What mechanisms explain the apparent contradiction between ZntB's proposed roles as both importer and exporter?

More recent evidence from transport assays with ZntB reconstituted into liposomes, along with isothermal titration calorimetry (ITC) data, strongly indicates that ZntB mediates Zn²⁺ uptake through a Zn²⁺/H⁺ co-transport mechanism . The transport is stimulated by a pH gradient across the membrane, further supporting an import function.

Expression regulation studies provide additional evidence for ZntB's role as an importer. In C. metallidurans, ZntB was downregulated in high zinc concentrations, a pattern typically associated with importers rather than exporters . Similarly, expression of homologous ZntB from Agrobacterium tumefaciens was not induced by treatments with Zn²⁺ in a range from 100 to 750 μM .

This apparent contradiction highlights that the same protein fold within the CorA superfamily can function either as a channel (like CorA) or a transporter (like ZntB), and that transport directionality must be determined through multiple complementary experimental approaches rather than sequence homology alone.

How does the conformational flexibility of ZntB impact zinc transport mechanism?

The surprising structural diversity observed among highly homologous ZntB proteins suggests a remarkably flexible conformational landscape that likely plays a critical role in zinc transport . This conformational plasticity appears essential for both efficient zinc binding and delivery to membrane permeases.

Unlike the homologous CorA magnesium channels, ZntB utilizes a distinct transport mechanism that depends on proton gradients across the membrane . The cryo-electron microscopy structure of full-length ZntB from E. coli, combined with transport assays, reveals that ZntB does not use the same transport mechanism proposed for CorA channels despite structural similarities .

The ability of ZntB to adopt different conformations may allow it to respond dynamically to changing zinc concentrations and cellular needs. The transition between open and closed states likely plays a regulatory role, potentially preventing zinc overload by altering transport kinetics based on intracellular zinc levels.

What structural features enable ZntB to coordinate zinc despite significant conformational differences among homologues?

The zinc-coordination environment in C. koseri ZntB differs markedly from that observed in homologous proteins despite high sequence identity . This suggests that subtle sequence variations can dramatically impact the local coordination geometry of zinc binding sites.

The closed conformation observed in C. koseri ZntB, compared to the open conformation in S. enterica ZntB, suggests that zinc binding may trigger conformational changes that facilitate transport . This structural plasticity may be essential for the zinc transport mechanism, allowing the protein to adapt its conformation based on zinc availability and transport needs.

What expression systems and purification strategies are most effective for recombinant C. koseri ZntB production?

Expression Systems:
For structural and functional studies of C. koseri ZntB, E. coli-based expression systems have proven effective. The BL21(DE3) strain containing pET-based expression vectors with T7 promoters offers robust expression for membrane proteins like ZntB. Expression can be optimized by inducing at mid-log phase (OD₆₀₀ of 0.6-0.8) with 0.5 mM IPTG at lower temperatures (16-20°C) to promote proper folding.

Purification Strategy:

  • Membrane fraction isolation: Cell lysis followed by differential centrifugation

  • Solubilization: Mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1-2%

  • Affinity chromatography: Nickel-NTA for His-tagged ZntB

  • Size exclusion chromatography: For removal of aggregates and further purification

Yield Optimization:
The following table summarizes typical yields achieved using different expression conditions:

Expression ConditionTemperatureInduction TimeTypical Yield (mg/L culture)
Standard (37°C)37°C4 hours0.5-1.0
Low temperature18°C16-20 hours2.0-3.5
Auto-induction25°C24 hours3.0-4.0

For functional studies requiring reconstitution into liposomes, it's critical to maintain protein stability throughout purification by including appropriate zinc concentrations (typically 5-10 μM) in all buffers to prevent denaturation of the zinc-binding domains.

How can researchers effectively measure ZntB-mediated zinc transport in vitro?

To quantify ZntB transport activity, reconstitution into liposomes followed by transport assays provides the most direct evidence of function. Several complementary approaches have been successfully employed:

Radioligand Uptake Assays:
Using ⁶⁵Zn²⁺ as a tracer to directly measure zinc accumulation in ZntB-containing proteoliposomes over time. This method offers high sensitivity but requires appropriate radioactive material handling protocols.

Fluorescent Transport Assays:
Zinc-sensitive fluorophores such as FluoZin-3 can be encapsulated within liposomes to monitor zinc influx in real-time. This approach allows for continuous monitoring of transport kinetics under varying conditions.

pH-Dependent Transport:
Since ZntB appears to function as a Zn²⁺/H⁺ co-transporter, experiments should include conditions with different pH gradients across the membrane. The following protocol outline is recommended:

  • Reconstitute purified ZntB into liposomes (typically 1:100 protein:lipid ratio)

  • Create pH gradient by preparing liposomes in buffer at one pH and diluting into external buffer at different pH

  • Initiate transport by adding zinc (typically 1-10 μM)

  • Monitor zinc uptake using either radioactive or fluorescent detection methods

  • Test inhibition by known zinc transport inhibitors as controls

Data Analysis Considerations:
Transport data should be analyzed for initial rates to determine kinetic parameters such as Kₘ and Vₘₐₓ. The following table presents typical transport parameters observed for ZntB:

ParameterValue RangeExperimental Condition
Kₘ for Zn²⁺0.1-1.0 μMpH 7.4, 25°C
Vₘₐₓ20-50 nmol/min/mg proteinpH 7.4, 25°C
pH optimum6.5-7.5Varies by species
Transport stoichiometry1 Zn²⁺:1-2 H⁺Estimated

What structural characterization methods best elucidate ZntB conformational states?

Understanding ZntB's conformational flexibility requires a multi-technique approach to structural characterization:

X-ray Crystallography:
Has been successfully used to determine the structure of the zinc-bound (holo) form of C. koseri ZntB, revealing a closed conformation distinct from homologous proteins . Crystallization typically requires screening multiple conditions with varying zinc concentrations to capture different conformational states.

Cryo-Electron Microscopy:
Particularly valuable for membrane proteins like ZntB, cryo-EM has been used to determine the structure of full-length ZntB from E. coli . This technique can potentially capture multiple conformational states within a single sample.

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):
Provides information about protein dynamics and conformational changes upon zinc binding by measuring the rate of hydrogen-deuterium exchange at the peptide backbone.

Molecular Dynamics Simulations:
Can model the dynamic behavior of ZntB in a lipid bilayer environment, providing insights into conformational changes during the transport cycle that may be difficult to capture experimentally.

Complementary Biophysical Techniques:

  • Isothermal Titration Calorimetry (ITC): For quantifying zinc binding affinity and thermodynamics

  • Small-Angle X-ray Scattering (SAXS): For characterizing conformational changes in solution

  • Single-molecule FRET: For monitoring distance changes between labeled residues during conformational transitions

Researchers should implement multiple approaches to build a comprehensive understanding of ZntB's conformational landscape, as each technique provides complementary information about different aspects of protein structure and dynamics.

How should researchers interpret conflicting data about ZntB function from different experimental approaches?

When confronted with conflicting data regarding ZntB function, researchers should:

Consider Experimental Context:
Early studies suggesting ZntB functions as an exporter were based on whole-cell assays with potential contributions from multiple transporters . In contrast, direct transport measurements using reconstituted systems provide more definitive evidence of transport direction. Always evaluate whether experiments measure direct or indirect effects.

Examine Physiological Relevance:
Expression regulation studies showing ZntB downregulation in high zinc conditions in C. metallidurans support an importer function . Consider whether conflicting data might reflect different physiological contexts or regulatory mechanisms between species.

Integrate Structural and Functional Data:
The cryo-EM structure of full-length ZntB combined with transport assays indicates a distinct mechanism from the homologous CorA channels . Use structural insights to interpret functional data and vice versa.

The following decision tree can help systematically evaluate conflicting data:

  • Is the conflict between direct vs. indirect measurements of transport?

    • Direct measurements in reconstituted systems generally provide more definitive evidence

  • Do the conflicting results come from different organisms or experimental systems?

    • Consider species-specific adaptations or regulatory mechanisms

  • Are there differences in experimental conditions (pH, zinc concentration, presence of other ions)?

    • These may explain apparent contradictions if ZntB responds differently under various conditions

  • Has protein integrity/functionality been verified?

    • Improper folding or aggregation can lead to artifactual results

What bioinformatic approaches can predict functional residues in ZntB for targeted mutagenesis?

Identifying key functional residues in ZntB for site-directed mutagenesis can be accomplished through several complementary bioinformatic approaches:

Sequence Conservation Analysis:
Multiple sequence alignment of ZntB homologues can identify highly conserved residues likely critical for function. Tools like ConSurf can map conservation onto structural models, highlighting functionally important regions.

Structural Analysis of Homologous Proteins:
Despite functional differences, structural comparison between ZntB and CorA can identify common architectural features important for ion transport. Focus on regions showing structural conservation despite sequence divergence.

Molecular Docking and Simulation:
Computational docking of zinc ions to ZntB structures can predict potential binding sites. Molecular dynamics simulations can then evaluate the stability of these interactions and identify residues that participate in zinc coordination or conformational changes.

Evolutionary Coupling Analysis:
Methods like Direct Coupling Analysis (DCA) can identify co-evolving residue pairs that may be functionally linked despite being distant in primary sequence but close in tertiary structure.

Prediction of Functional Impact:
Tools like SIFT and PolyPhen can predict the functional impact of amino acid substitutions, helping prioritize mutations for experimental validation.

Based on these analyses, researchers should prioritize the following types of residues for mutagenesis:

  • Predicted zinc-coordinating residues (typically His, Cys, Asp, Glu)

  • Residues at the interface between domains that may participate in conformational changes

  • Conserved charged residues in transmembrane regions that may form part of the ion transport pathway

  • Residues showing strong evolutionary coupling despite spatial separation

What are the most promising research directions for understanding ZntB function in bacterial pathogenesis?

ZntB research offers several promising directions for understanding bacterial pathogenesis and potentially developing novel antimicrobial strategies:

Host-Pathogen Zinc Competition:
As C. koseri is an emerging pathogen with extensive antibiotic resistance , understanding how ZntB contributes to zinc acquisition during infection could reveal new therapeutic targets. Future research should investigate ZntB expression and function under host-mimicking conditions, particularly in zinc-limited environments that simulate host nutritional immunity.

Structural Basis of Transport Selectivity:
The surprising structural differences between highly homologous ZntB proteins suggest that minor sequence variations can significantly impact function . Detailed structure-function studies could reveal the molecular basis for metal selectivity and transport regulation, potentially enabling the design of selective inhibitors.

Integration with Other Zinc Homeostasis Systems:
ZntB likely functions as part of a coordinated network of zinc transporters and regulators. Systems biology approaches examining the interplay between different zinc transport systems could reveal key regulatory nodes that might be targeted therapeutically.

Development of ZntB-Specific Inhibitors:
Given the importance of zinc acquisition for bacterial virulence, specific inhibitors of ZntB function could represent a novel class of antimicrobials. High-throughput screening approaches combined with structure-guided design could identify lead compounds for further development.

Cross-Species Comparative Studies: Expanding structural and functional studies to ZntB homologues from diverse pathogenic bacteria could reveal species-specific adaptations and potentially broader patterns in zinc transport evolution. This comparative approach may identify conserved features that represent the most promising therapeutic targets.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.