Recombinant Citrullus lanatus NADH-ubiquinone oxidoreductase chain 1 (ND1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have a specific format preference, please indicate your requirement in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
ND1; NAD1; NADH-ubiquinone oxidoreductase chain 1; NADH dehydrogenase subunit 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Citrullus lanatus (Watermelon) (Citrullus vulgaris)
Target Names
ND1
Target Protein Sequence
MSWPILTSFMRSWTTKPPPQIKMSPMRLSWQEPFFDCDFFCGFGQVIEAKERCFPSVKSR YRPPHAPPVRLPRNRKGRTGARASWVGVKSRKRGGGLLGTFTPLYSKYAFLGALRSAAQM VPYEVSIGLILIVRLICVGPRNSSEIVMAQKQIWSGIPLFPVLVMFFISRLAETNRAPFD LPEAEAESVAGYNVEYAWDAILNSPLLAEANVPGXPGTHSDNKITLFILIGVDACRGREL FILHSKLMNVGWKVFLPLSLAWVVAVSFLQILLLFIKAHPNLRRDYALALSYHLYNWGSS FIDGFFFWKREKKNFL
Uniprot No.

Target Background

Function
This protein serves as the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be essential for the minimal assembly required for catalytic activity. Complex I plays a role in transferring electrons from NADH to the respiratory chain. The immediate electron acceptor for this enzyme is thought to be ubiquinone.
Protein Families
Complex I subunit 1 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Methodological Questions

  • What are the most effective purification protocols for recombinant Citrullus lanatus ND1?

Purification of recombinant Citrullus lanatus ND1 typically follows a multi-step process that balances yield, purity, and retention of function:

  • Initial extraction: For E. coli-expressed ND1, cell lysis is typically performed with buffer containing appropriate detergents (0.5-1% DDM, LDAO, or OG) to solubilize the membrane protein.

  • Affinity chromatography: If the recombinant protein contains a His-tag, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is the primary purification step.

    Buffer ComponentConcentrationPurpose
    Tris or phosphate20-50 mMpH buffering (pH 7.4-8.0)
    NaCl100-500 mMIonic strength
    Imidazole10-20 mM → 250-500 mMBinding → Elution
    Detergent0.05-0.1%Maintain solubility
    Glycerol5-10%Stabilization
  • Secondary purification: Ion exchange or size exclusion chromatography to remove contaminants and aggregates.

  • Quality control: Analyze purity by SDS-PAGE (target >85% purity) and verify identity by mass spectrometry or Western blotting .

  • Storage: The purified protein is typically stored in a buffer containing 50% glycerol at -20°C or -80°C to maintain stability .

For long-term storage, lyophilization from a 0.22μm filtered solution in PBS (pH 7.4) with approximately 8% trehalose as a protectant is recommended .

  • How can the functional activity of recombinant Citrullus lanatus ND1 be reliably measured?

The functional activity of recombinant Citrullus lanatus ND1 can be assessed through several complementary approaches:

  • Spectrophotometric NADH oxidation assay: Measures the rate of NADH oxidation in the presence of ubiquinone analogs such as decylubiquinone or coenzyme Q1.

    ComponentConcentrationNotes
    NADH100-200 μMSubstrate
    Decylubiquinone50-100 μMElectron acceptor
    Potassium phosphate buffer20-50 mM, pH 7.4Reaction buffer
    Recombinant ND10.1-1 μg/mLEnzyme

    The decrease in absorbance at 340 nm (ε = 6.22 mM⁻¹cm⁻¹) is monitored to calculate the rate of NADH oxidation.

  • Oxygen consumption assay: Using an oxygen electrode to measure respiratory activity in reconstituted proteoliposomes containing ND1.

  • Artificial electron acceptor assays: Alternative electron acceptors like ferricyanide can be used to bypass the natural acceptor.

  • Coupled enzyme assays: Similar to methods used for other plant enzymes, ND1 activity can be coupled to secondary enzymes like alcohol dehydrogenase, where NADH oxidation drives the reduction of aldehydes to alcohols, which can be monitored spectrophotometrically .

  • Inhibitor sensitivity profile: Measuring activity in the presence of known Complex I inhibitors (rotenone, piericidin A) can confirm specificity.

For comparative analysis, normalize activity to protein concentration and report as nmol NADH oxidized/min/mg protein under standardized conditions.

  • How can recombinant Citrullus lanatus ND1 be used to study mitochondrial dysfunction in plant systems?

Recombinant Citrullus lanatus ND1 provides a valuable tool for investigating mitochondrial dysfunction in plant systems through several experimental approaches:

  • In vitro reconstitution studies: Recombinant ND1 can be incorporated into liposomes with other Complex I components to study how specific mutations affect electron transport activity.

  • Complementation experiments: In systems where endogenous ND1 is compromised, recombinant protein can be introduced to assess functional rescue.

  • Structure-function analysis: Site-directed mutagenesis of recombinant ND1 can identify critical residues for function by comparing wild-type and mutant activity.

  • Oxidative stress models: Recombinant ND1 can be exposed to reactive oxygen species to study damage patterns and functional consequences.

  • Comparative studies: Comparing the properties of ND1 from different Citrullus lanatus cultivars may reveal adaptations to different environmental conditions or stress responses.

  • Plant transformation applications: Recombinant ND1 expression constructs can be used in transgenic approaches to study mitochondrial function in planta, similar to approaches used with other Citrullus lanatus genes such as hydroperoxide lyase .

The combined analysis of both structural integrity and functional activity of recombinant ND1 under various conditions can provide insights into mechanisms of mitochondrial dysfunction in plants.

  • What genomic tools and resources are available for studying ND1 and related genes in Citrullus lanatus?

Several genomic tools and resources are available for studying ND1 and related genes in Citrullus lanatus:

  • Genome databases and browsers:

    • The Citrullus lanatus genome assembly (Cla97_v1) is available through Ensembl Plants

    • The genome contains 23,440 predicted protein-coding genes

  • Transcriptomic resources:

    • RNA-seq data from various tissues and developmental stages

    • Transcriptome dynamics studies across different flesh-colored watermelon varieties

  • Comparative genomics:

    • Resequencing data from 20 watermelon accessions representing three different C. lanatus subspecies

    • Evolutionary analysis of watermelon chromosomes derived from a 7-chromosome paleohexaploid eudicot ancestor

  • Genetic modification tools:

    • Methods for Agrobacterium-mediated transformation of Citrullus lanatus have been established

    • Binary vectors (e.g., pKYLX71:35S2) with CMV 35S promoters have been used successfully for watermelon gene expression

  • Gene expression analysis platforms:

    • Weighted gene co-expression network analysis (WGCNA) methodologies have been applied to watermelon genes

    • Differentially expressed gene (DEG) analysis protocols during fruit development stages

The watermelon genome sequencing revealed that many disease-resistance genes were lost during domestication , which has implications for understanding the evolution of mitochondrial genes like ND1 that may have adapted during the domestication process.

Advanced Experimental Approaches

  • How can heterologous expression systems be optimized for producing functional Citrullus lanatus ND1?

Optimizing heterologous expression of functional Citrullus lanatus ND1 requires addressing several challenges specific to membrane proteins:

  • Codon optimization strategies:

    • Adapt the coding sequence to the codon usage bias of the expression host

    • Remove rare codons that might cause translational pausing

  • Expression vector design:

    • Use low to moderate strength inducible promoters to prevent inclusion body formation

    • Consider fusion partners that enhance solubility (MBP, SUMO, Trx)

    • Include cleavable tags for subsequent purification (His, GST, FLAG)

  • Specialized E. coli strains:

    • C41(DE3) and C43(DE3): Derived from BL21(DE3), specifically adapted for membrane protein expression

    • Lemo21(DE3): Allows tunable expression through T7 lysozyme regulation

    • SHuffle: Enhanced disulfide bond formation in the cytoplasm

  • Induction conditions:

    • Lower temperatures (16-20°C) to slow protein synthesis and folding

    • Reduced inducer concentration to prevent overwhelming the membrane insertion machinery

    • Extended expression time (24-48 hours) to maximize yield of properly folded protein

  • Media and supplements:

    • Enriched media containing additional phospholipids

    • Osmolytes (glycerol, betaine) to stabilize protein folding

    • Trace metal supplementation for cofactor incorporation

  • Extraction optimization:

    • Screen multiple detergent types and concentrations for optimal solubilization

    • Two-step extraction approach: mild conditions for properly folded protein followed by harsher conditions

Based on related research with watermelon proteins, adapting these strategies can significantly improve functional yields, as demonstrated with other challenging watermelon enzymes like hydroperoxide lyase that showed exceptional activity when properly expressed .

  • What are the current challenges and future directions in research involving Citrullus lanatus ND1 and mitochondrial function?

Current challenges and future directions in research involving Citrullus lanatus ND1 and mitochondrial function include:

  • Structural characterization challenges:

    • Limited high-resolution structural data for plant-specific Complex I components

    • Difficulties in crystallizing membrane proteins for X-ray crystallography

    • Need for advanced cryo-EM approaches to resolve plant-specific features

  • Functional integration questions:

    • How plant-specific post-translational modifications affect ND1 function

    • Role of ND1 in supercomplexes with other respiratory chain components

    • Adaptation of mitochondrial function during fruit development and ripening

  • Evolutionary perspectives:

    • Comparison of ND1 across Citrullus lanatus varieties with different environmental adaptations

    • Impact of domestication on mitochondrial gene function

    • RNA editing patterns and their functional significance

  • Applied research opportunities:

    • Engineering enhanced respiratory efficiency for improved crop performance

    • Understanding mitochondrial contributions to fruit quality traits

    • Developing mitochondrial markers for watermelon breeding programs

  • Technological developments needed:

    • Improved methods for site-specific labeling of membrane proteins

    • Advanced reconstitution systems mimicking native membrane environments

    • Non-invasive methods to monitor mitochondrial function in intact tissues

The genomic and transcriptomic resources available for Citrullus lanatus provide a foundation for addressing these challenges, potentially leading to deeper understanding of plant mitochondrial function and its role in crop improvement.

The integration of recombinant protein studies with broader genomic and physiological approaches will be crucial for advancing our understanding of how ND1 contributes to mitochondrial function in watermelon and other plant species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.