Recombinant Citrus leprosis virus C Uncharacterized protein p24 (p24)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
p24; ORF4; Uncharacterized protein p24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Species
Citrus leprosis virus C (isolate Citrus sinesis/Brazil/Cordeiropolis/2003) (CiLV-C)
Target Names
p24
Target Protein Sequence
MDAQLLQANKRLLRRAANVRQRYKMLATESFVADIKQILLRFIQKPNVIIMYISVLVLFA AHIDSNTHDILDDLAAQFPNNTFIEWAKSNFFRICGALVFIPVIIDTEEKHRNYLALVIF VFLMGFPQRSIMEYFIYSISFHVYAKAKHPVTRIFIIGAAVFSCVMFGIFTNEQLRKLYA ELPKVPTHPVAVNRVEKVANRASRVSTEGTVNFG
Uniprot No.

Target Background

Database Links

KEGG: vg:4155848

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the p24 protein of Citrus leprosis virus C?

The p24 protein is one of the proteins encoded by RNA2 of Citrus leprosis virus C (CiLV-C), a member of the family Kitaviridae. Based on its membrane topology and homology analysis, p24 likely functions as a structural protein with potential matrix protein properties. Its sequence shows homology to virion membrane proteins found in both plant and arthropod viruses . While the complete characterization of p24 remains ongoing, research suggests it contributes to the viral structure and possibly to the pathogen's interaction with host cells during infection.

What are the expression patterns of p24 during CiLV-C infection?

The p24 gene expression follows a similar pattern to other CiLV-C proteins during infection. Studies in Arabidopsis thaliana have shown that p24 gene expression remains relatively invariable during the first 24 hours after infestation (hai) with viruliferous mites. After this initial period, p24 expression increases continuously throughout the infection process . This expression pattern aligns with genes like p15, p61, and MP, suggesting coordinated expression of these viral proteins during the infection cycle. Quantitative analysis through RT-qPCR has been effectively used to track these expression patterns over time.

How does the p24 protein relate to CiLV-C's inability to become systemic?

CiLV-C infections remain localized in host plants and do not become systemic under field conditions. While the exact mechanisms preventing systemic infection remain unknown, structural proteins like p24 may play a role in this limitation . As a potential matrix protein with specific membrane topology, p24 could influence viral assembly, movement, and host-pathogen interactions. Understanding p24's structural characteristics and functional domains may provide insights into why CiLV-C cannot infect phloem tissues, which prevents its systemic spread throughout host plants.

What methodologies are most effective for studying recombinant p24 protein expression?

For recombinant expression of CiLV-C p24, researchers should consider several methodological approaches:

How can researchers investigate p24's role in viral pathogenicity?

To investigate p24's contribution to viral pathogenicity, researchers should consider these methodological approaches:

  • Transient Expression Assays: Express p24 independently in plant systems to evaluate whether it induces cellular responses similar to those observed during CiLV-C infection. This approach has been successfully used for other CiLV-C proteins that showed capacity to trigger necrosis responses .

  • Viral Vector Systems: Leverage heterologous viral systems such as Potato virus X (PVX) or Turnip crinkle virus (TCV) to express p24 and assess changes in pathogenicity. This approach revealed that p29, p15, and p61 of CiLV-C enhanced PVX RNA accumulation and pathogenicity .

  • Hypersensitive Response Assays: Evaluate whether p24 triggers hypersensitive response (HR) by expressing it in Nicotiana benthamiana, similar to tests performed with p61 which resulted in HR . Document cell death development and quantify defense-related gene expression.

  • Protein-Protein Interaction Studies: Employ yeast two-hybrid, co-immunoprecipitation, or bimolecular fluorescence complementation (BiFC) to identify p24 interactions with host proteins that could influence pathogenicity.

What structural and functional analyses provide insights into p24 membrane topology?

Understanding p24's membrane topology requires multiple complementary approaches:

  • Computational Prediction: Begin with bioinformatic analyses using transmembrane prediction algorithms (TMHMM, Phobius) to identify potential membrane-spanning domains and topological orientation.

  • Protease Protection Assays: Express p24 in microsomal fractions and subject them to protease treatment. Protected regions indicate membrane-embedded or lumenal domains. This technique has contributed to understanding p24's membrane topology in previous studies .

  • Glycosylation Site Mapping: Introducing artificial N-glycosylation sites at various positions can help determine which portions of the protein are exposed to the ER lumen.

  • Cysteine Accessibility Methods: Substituting amino acids with cysteines followed by selective labeling with membrane-permeable or impermeable reagents can reveal the orientation of specific protein regions.

  • Cryo-Electron Microscopy: For higher resolution structural analysis, purified recombinant p24 reconstituted in lipid environments can be analyzed by cryo-EM to determine membrane association patterns.

How does p24 interact with the plant immune system during infection?

The interaction between CiLV-C p24 and the plant immune system can be investigated through these methodologies:

  • Transcriptome Analysis: Compare plant gene expression profiles during infection with CiLV-C versus transient expression of p24 alone. RNA-Seq has previously revealed that CiLV-C infection triggers ROS burst, cell death, RNA silencing, and SA pathway activation .

  • Defense Marker Gene Expression: Quantify the expression of defense-related genes such as those involved in SA signaling, ROS production, and HR using RT-qPCR in p24-expressing tissues .

  • Virus-Induced Gene Silencing (VIGS): Silence specific plant defense pathway components before p24 expression to identify which immune pathways are engaged by this protein.

  • Reactive Oxygen Species Measurement: Use luminol-based assays or specific dyes (DCF-DA, DAB staining) to quantify and visualize ROS production in response to p24 expression.

  • MAPK Activation Assays: Western blot analysis using phospho-specific antibodies can detect activation of immune-related MAP kinases following p24 expression.

What are the best approaches for detecting p24 in infected plant tissues?

For sensitive and specific detection of p24 in research contexts:

  • RT-PCR and RT-qPCR: Design primers targeting the p24 ORF for RNA detection. RT-qPCR has been successfully used to quantify CiLV-C RNA accumulation during infection . Primer design should consider sequence conservation across different CiLV-C isolates.

  • High-Throughput Sequencing (HTS): RNA extracted from infected tissues can be analyzed using total RNA sequencing after rRNA depletion. This approach has proven effective for detecting CiLV-C in various hosts and can provide complete coverage of viral genomes including the p24 coding region .

  • Immunological Methods: Development of specific antibodies against p24 would enable detection through ELISA, immunoblotting, or immunofluorescence microscopy. While CiLV-C antibodies have been developed, they are not commercially available and may require custom production .

  • Bioinformatic Analysis: For HTS data, apply specialized pipelines including adapter trimming, quality filtering, de novo assembly, and database searches as outlined in previous studies . This approach can detect minor sequence variations in the p24 gene across different viral isolates.

How should researchers design experiments to compare wild-type versus mutant p24 proteins?

A comprehensive experimental design for p24 mutagenesis studies should include:

  • Mutation Strategy Planning:

    • Alanine scanning: Systematically replacing conserved amino acids with alanine

    • Domain deletion: Removing predicted functional domains

    • Chimeric constructs: Swapping domains with related viral proteins

  • Expression Systems Comparison:

    • Bacterial expression (E. coli) for protein purification and in vitro studies

    • Plant-based expression (N. benthamiana) for in vivo functionality

    • Yeast expression for protein-protein interaction studies

  • Functional Assays:

    • Membrane binding assays to compare wild-type versus mutant membrane association

    • Protein stability measurements using pulse-chase experiments

    • Subcellular localization using confocal microscopy

  • Data Analysis Framework:

    • Statistical comparison using appropriate tests (ANOVA, t-test) with multiple testing correction

    • Quantitative image analysis for localization studies

    • Protein structure prediction to interpret mutation effects

What contradictions exist in the current understanding of p24 function and how can they be resolved?

The limited information about p24 creates several research gaps rather than direct contradictions. These knowledge gaps can be addressed through:

  • Comparative Analysis: The homology between p24 and matrix proteins of other viruses suggests structural functions, but direct evidence of its role in virion formation is lacking . Resolution requires:

    • Immunogold labeling and electron microscopy of virus particles

    • Knock-down or mutation studies to assess virion formation in the absence of functional p24

    • Systematic interaction studies with other viral structural proteins

  • Localized Infection Paradox: CiLV-C causes only localized lesions despite encoding movement proteins . To investigate p24's potential role in this limitation:

    • Compare p24 sequences across cileviruses with different host ranges

    • Perform grafting experiments with p24-expressing tissues

    • Investigate p24 interactions with plasmodesmata and phloem proteins

  • Methodological Approaches for Resolution:

    • Develop infectious clones of CiLV-C for reverse genetics studies

    • Apply cryo-electron tomography to visualize virus-host interactions

    • Use proteomics to identify host proteins that interact with p24

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.