Recombinant Citrus leprosis virus C Uncharacterized protein p61 (p61)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Citrus Leprosis Virus C Uncharacterized Protein p61 (p61)

Recombinant Citrus Leprosis Virus C Uncharacterized protein p61, also known as p61, is a protein associated with the Citrus leprosis virus C (CiLV-C) . CiLV-C is a non-systemic virus that causes lesions on citrus plants and is transmitted by Brevipalpus mites . The p61 protein is considered a viral effector that triggers hypersensitive-like responses in plants .

Basic Information

CategoryDescription
Synonymsp61, Uncharacterized protein p61
SourceE. coli
SpeciesCitrus leprosis virus C (CiLV-C)
Protein LengthFull Length of Mature Protein (16-537 aa)
TagHis
UniProt IDQ1KZ56
Amino Acid SequenceLVSNIYNSTGHLSIDKACSGYSTEVFKGVCLPSYSYVKVDRHILTKDDRYYLGYAKATNREYQLYSLHIGTYDLFGSDIMSCGARGYALGLHNGDLELVLNYCRKVDGQKHIGEVFQSCRFVEYSEHMISGIVHSIPKDLMEEFSPIGKVPYFGIMPFRTECADQCSTKQAFYAMDAYPFYNIGYWFPLCADKYIPLCYSGRTDPCPLGYEERLIKVHSYMEGFESGMKTVCKSGEYIFPAWYSGQSEIYDTVVKPYIVNVPEYCGRFSRSDKSLVYSRFGFRGTIFSGLKVITLDGIDYLTTDFCVNYSMHHYVKPLVFERMRKSFICTSSGCLYKGFDVNHLHDICTPKLIVKRHEALISSFSFINTLGTKVGAVPYDFDGNIIQFIDVFSIDGFYVYSLSHKKIQTLTVMLVQSEEEWYMKLLHFVADDILRECLSTVFKVLFSAISACLSFIIDVGGCCFRQFIFVCLDSVILLLLLLPNYTHLTFILGFTLNAYIQLVYYESCCFRAYRDIAETIDL

Role in Plant-Virus Interaction

The CiLV-C p61 protein induces several defense responses in plants . Expression of p61 leads to a burst of reactive oxygen species (ROS), upregulation of salicylic acid (SA) and hypersensitive response (HR)-related genes, increased SA levels, and reduced jasmonic acid (JA) levels, eventually causing cell death . These responses are similar to those observed during CiLV-C infection, suggesting p61 functions as a viral effector that contributes to the HR-like symptoms associated with the infection .

RNA Silencing Suppressor (RSS) Activity

The p61 protein of CiLV-C has demonstrated RNA silencing suppressor (RSS) activity . When tested using the alfalfa mosaic virus (AMV) system, p61 triggered necrosis and increased AMV RNA 3 accumulation, indicating a suppressive function . Additionally, ectopic expression of p61 reduced the accumulation of GFP-derived siRNAs .

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates. Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process. The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
p61; Uncharacterized protein p61
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
16-537
Protein Length
Full Length of Mature Protein
Species
Citrus leprosis virus C (isolate Citrus sinesis/Brazil/Cordeiropolis/2003) (CiLV-C)
Target Names
p61
Target Protein Sequence
LVSNIYNSTGHLSIDKACSGYSTEVFKGVCLPSYSYVKVDRHILTKDDRYYLGYAKATNR EYQLYSLHIGTYDLFGSDIMSCGARGYALGLHNGDLELVLNYCRKVDGQKHIGEVFQSCR FVEYSEHMISGIVHSIPKDLMEEFSPIGKVPYFGIMPFRTECADQCSTKQAFYAMDAYPF YNIGYWFPLCADKYIPLCYSGRTDPCPLGYEERLIKVHSYMEGFESGMKTVCKSGEYIFP AWYSGQSEIYDTVVKPYIVNVPEYCGRFSRSDKSLVYSRFGFRGTIFSGLKVITLDGIDY LTTDFCVNYSMHHYVKPLVFERMRKSFICTSSGCLYKGFDVNHLHDICTPKLIVKRHEAL ISSFSFINTLGTKVGAVPYDFDGNIIQFIDVFSIDGFYVYSLSHKKIQTLTVMLVQSEEE WYMKLLHFVADDILRECLSTVFKVLFSAISACLSFIIDVGGCCFRQFIFVCLDSVILLLL LLPNYTHLTFILGFTLNAYIQLVYYESCCFRAYRDIAETIDL
Uniprot No.

Target Background

Database Links

KEGG: vg:4155851

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is Citrus leprosis virus C and what is its significance in plant pathology?

Citrus leprosis virus C (CiLV-C) is the type member of the genus Cilevirus within the family Kitaviridae. It is considered the most devastating virus infecting citrus in Brazil and the main viral pathogen responsible for citrus leprosis (CL), a severe disease affecting citrus orchards throughout Latin America .

Unlike most plant viruses, CiLV-C does not spread systemically in any of its known host plants. Instead, infection remains restricted to localized lesions around the feeding sites of its vector, Brevipalpus mites . This unusual characteristic makes CiLV-C a unique model for studying restricted viral infections and plant defense responses.

Methodologically, researchers investigate CiLV-C by:

  • Transmission experiments using viruliferous Brevipalpus mites

  • RT-qPCR to quantify viral RNA accumulation in different infection stages

  • RNA-Seq to analyze global plant responses to infection

  • Transient expression of individual viral proteins to determine their specific functions

What is the p61 protein and what is known about its structure and function?

The p61 protein is one of the proteins encoded by RNA2 of the CiLV-C genome. It is a putative glycoprotein with 537 amino acids (positions 16-537 in the mature protein) . Recent studies have characterized p61 as a multifunctional protein with several key biological activities:

  • RNA silencing suppressor (RSS) activity

  • Induction of hypersensitive response (HR) in plant tissues

  • Modulation of plant defense pathways (upregulation of SA and downregulation of JA pathways)

While p61 was initially described as an "uncharacterized protein," recent molecular analyses have revealed its importance in CiLV-C pathogenicity and plant-virus interactions. The protein sequence shows distant homology with structural proteins of insect-specific negeviruses, suggesting potential evolutionary connections .

Recombinant p61 protein has been successfully expressed with an N-terminal His-tag in E. coli systems for functional studies .

What systems and approaches are used to study p61 protein function?

Multiple experimental systems have been employed to characterize p61 function, each providing specific insights into its biological activities:

Experimental SystemMethodologyKey Findings for p61Reference
GFP-based reporter assayAgroinfiltration of p61 construct with GFP reporter in N. benthamiana 16c plantsNo local suppressor activity detected
Alfalfa mosaic virus (AMV) systemExpression of p61 in AMV infection contextTriggered necrosis and increased AMV RNA 3 accumulation
siRNA accumulation analysisAnalysis of GFP-derived siRNAs in plants expressing p61Significant reduction in siRNA accumulation
Turnip crinkle virus (TCV) systemTrans-expression of p61 with RSS-defective TCVDid not restore cell-to-cell viral movement
Potato virus X (PVX) systemExpression of p61 in PVX infection contextIncreased PVX RNA accumulation; induced hypersensitive response
Transient expression in N. benthamianaAgroinfiltration of p61 constructTriggered ROS burst, upregulated SA-related genes, increased SA levels, reduced JA levels, caused cell death

When designing experiments to study p61, researchers should consider combining multiple approaches, as findings from different systems provide complementary information about the protein's function.

How can researchers effectively produce and purify recombinant p61 protein for functional studies?

For researchers seeking to work with purified p61 protein, the following methodological approach is recommended based on successful expression strategies :

  • Gene optimization and construct design:

    • Clone the p61 gene sequence (positions 16-537) into an expression vector

    • Add an N-terminal His-tag for purification purposes

    • Optimize codon usage for the expression system (e.g., E. coli)

  • Expression conditions:

    • Use E. coli as expression host

    • Induce protein expression under optimized conditions

    • Monitor expression by SDS-PAGE

  • Purification protocol:

    • Lyse cells using appropriate buffer systems

    • Purify using nickel affinity chromatography

    • Elute with imidazole

    • Consider additional purification steps (ion exchange or size exclusion chromatography)

    • Dialyze against Tris/PBS-based buffer with 6% trehalose, pH 8.0

    • Lyophilize for long-term storage

  • Storage recommendations:

    • Store lyophilized protein at -20°C/-80°C

    • Reconstitute in deionized sterile water (0.1-1.0 mg/mL)

    • Add 5-50% glycerol for aliquots intended for long-term storage

    • Avoid repeated freeze-thaw cycles

The purified recombinant protein should achieve >90% purity as determined by SDS-PAGE .

How does p61 function as an RNA silencing suppressor?

The RNA silencing suppressor (RSS) activity of p61 has been demonstrated through multiple experimental approaches, though the precise molecular mechanism remains under investigation :

  • Evidence for RSS activity:

    • p61 expression reduces accumulation of GFP-derived siRNAs

    • p61 enhances PVX RNA accumulation in infection contexts

    • p61 increases AMV RNA 3 accumulation

  • Proposed mechanism:

    • p61 likely interferes with steps after dsRNA production

    • It may bind to 21 and 24 nt siRNAs, preventing their incorporation into RNA-induced silencing complexes (RISC)

    • Unlike some silencing suppressors, p61 does not appear to function at the local silencing level in 16c plants

  • Methodological considerations for RSS investigation:

    • Researchers should employ multiple complementary assays rather than relying solely on the 16c plant system

    • Analysis of small RNA accumulation is more informative than fluorescent signal detection

    • Vector stability should be monitored in heterologous expression systems (e.g., PVX-p61)

Interestingly, p61 differs from many viral RSS proteins by simultaneously triggering plant defense responses, suggesting a dual role in plant-virus interactions .

What is the relationship between p61 and plant immune responses?

Research has established p61 as a key viral effector that triggers plant immune responses, particularly the hypersensitive response (HR) :

  • Activation of defense pathways:

    • p61 expression consistently triggers reactive oxygen species (ROS) burst

    • Upregulates salicylic acid (SA)-related genes

    • Increases SA levels

    • Reduces jasmonic acid (JA) levels

    • Causes localized cell death characteristic of HR

  • Transcriptomic evidence:

    • RNA-Seq analysis of CiLV-C infected Arabidopsis thaliana shows:

      • Progressive reprogramming of plant transcriptome with increasing viral loads

      • Induction of SA-mediated pathway

      • ROS burst and HR at the presymptomatic stage

      • Downregulation of JA/ET-mediated pathways

      • Suppression of primary metabolism including photosynthesis

      • Induction of unfolded protein response genes

  • Experimental validation:

    • Transient expression of p61 in Nicotiana benthamiana mimics the responses observed during CiLV-C infection

    • These responses include ROS burst, upregulation of SA- and HR-related genes, and cell death

The dual role of p61 as both an RSS and an inducer of plant defense suggests a complex evolutionary relationship between CiLV-C and its plant hosts. This paradoxical function may explain why CiLV-C remains restricted to local lesions and cannot spread systemically .

How does p61 compare with other CiLV-C proteins in terms of function and activity?

CiLV-C encodes multiple proteins with diverse functions. Comparative analysis of p61 with other viral proteins provides insights into their relative contributions to viral pathogenicity :

ProteinSizeFunctionRSS ActivityEffect on PVXHR Induction
p2929 kDaCapsid proteinYesEnhanced accumulation; increased pathogenicityNo
p1515 kDaUnknownYesEnhanced accumulation; increased pathogenicityNo
p6161 kDaPutative glycoproteinYesEnhanced accumulationYes
MPUnknownMovement proteinNoNot reportedNo
p2424 kDaUnknownNoNot reportedNo

Key differences and similarities:

  • p29, p15, and p61 all demonstrate RSS activity but through potentially different mechanisms

  • Only p61 induces a hypersensitive response in the PVX system

  • p15 uniquely restored cell-to-cell movement in the RSS-defective TCV system

  • p61 shows distant homology to structural proteins of insect-specific negeviruses, suggesting distinct evolutionary origins

The comparative analysis indicates that CiLV-C employs multiple proteins with overlapping functions to suppress host defenses, but p61 uniquely combines RSS activity with HR induction .

What can the study of p61 reveal about the evolution of kitavirids?

The study of p61 and its unusual properties provides important insights into the evolutionary history of kitavirids :

  • Evolutionary origin hypothesis:

    • CiLV-C and other kitavirids likely arose from an ancestral arthropod-infecting virus

    • p61 shows homology with proteins of insect-specific negeviruses

    • The combination of RSS activity with HR induction suggests incomplete adaptation to plant hosts

  • Evidence from infection phenotype:

    • The locally restricted infection pattern of CiLV-C, common across infections by kitavirids, suggests these viruses cannot fully circumvent plant defenses

    • p61-induced HR may represent an incompatible interaction between the virus and plant

  • Research implications:

    • Comparative genomic studies of p61 across kitavirids can reveal selective pressures

    • Experimental evolution studies tracking p61 sequence changes during adaptation might provide insights into virus-host coevolution

    • Phylogenetic analysis of p61 and homologous proteins in related viruses could help trace evolutionary history

The paradoxical functions of p61 support the hypothesis that CiLV-C represents an evolutionary intermediate that has not fully adapted to efficiently infect plants systemically .

How can the unique properties of p61 be leveraged for studying plant immune responses?

The dual function of p61 as both an RSS and HR inducer makes it a valuable tool for investigating plant immune responses :

  • As a model elicitor of plant defense responses:

    • p61 can be used to trigger and study SA-dependent responses

    • Its expression provides a controlled system for studying HR development

    • The protein can serve as a tool for investigating the relationship between ROS burst and cell death

  • For dissecting immune pathway crosstalk:

    • p61's ability to upregulate SA while downregulating JA pathways makes it useful for studying antagonistic interactions between these defense pathways

    • Researchers can use p61 expression to examine how plants prioritize different immune responses

  • As a tool for identifying new components of plant defense:

    • Genetic screens using p61 as an elicitor could identify novel regulators of HR

    • Proteomic approaches to identify p61-interacting proteins might reveal new immune components

    • Transcriptomic analysis of p61-expressing tissues can help identify genes involved in defense response regulation

  • Methodological approach:

    • Use inducible expression systems to control timing and intensity of p61 expression

    • Combine with genetic knockouts of known defense pathway components

    • Monitor physiological responses (ROS, ion fluxes) in real-time

    • Perform comparative analyses with known defense elicitors

What experimental approaches can resolve contradictory findings about p61 function?

Researchers have observed some apparently contradictory results regarding p61 function across different experimental systems. The following methodological approaches can help resolve these contradictions :

  • System-specific effects:

    • Use multiple experimental systems in parallel (16c plants, AMV, TCV, PVX)

    • Carefully control expression levels across systems

    • Consider the biological context of each system (different host factors may be present)

  • Protein domain analysis:

    • Generate and test truncated versions of p61 to identify functional domains

    • Use site-directed mutagenesis to identify key residues for different functions

    • Employ domain-swapping experiments with related proteins

  • Temporal dynamics:

    • Monitor p61 activities over time to distinguish between primary and secondary effects

    • Use inducible expression systems to control timing of p61 expression

    • Consider potential feedback mechanisms in interpretation of results

  • Interaction partners:

    • Identify host and viral proteins that interact with p61

    • Determine how these interactions affect p61 function

    • Consider potential post-translational modifications

  • Data analysis framework:

    • Develop clear criteria for interpreting experimental outcomes

    • Use appropriate statistical methods for comparing results across systems

    • Consider developing mathematical models to integrate diverse data sets

What are the most promising avenues for future research on p61?

Based on current knowledge, several research directions hold particular promise for advancing our understanding of p61 and its applications :

  • Structural biology:

    • Determine the three-dimensional structure of p61

    • Identify functional domains and active sites

    • Study protein-protein and protein-RNA interactions

  • Molecular mechanism:

    • Elucidate the precise mechanism of RSS activity

    • Identify plant targets of p61

    • Determine how p61 simultaneously suppresses RNA silencing while triggering HR

  • Evolutionary studies:

    • Compare p61 sequences across CiLV-C isolates

    • Analyze selective pressures on different protein domains

    • Investigate homologs in related viruses to trace evolutionary history

  • Applications in biotechnology:

    • Explore potential use of p61 domains as molecular tools

    • Investigate applications in engineering disease resistance

    • Develop p61-based systems for studying plant immune responses

  • Host range determinants:

    • Investigate how p61 contributes to CiLV-C host range

    • Study variation in plant responses to p61 across species

    • Identify host factors that interact with p61

  • Virus-vector interactions:

    • Explore potential roles of p61 in virus-mite interactions

    • Investigate whether p61 affects mite behavior or physiology

    • Study the evolutionary relationship between viral proteins and vector biology

How should researchers approach the development of control strategies based on p61 knowledge?

Understanding p61 function opens possibilities for developing novel control strategies for citrus leprosis disease :

  • RNA interference approaches:

    • Design RNAi constructs targeting p61

    • Express these in transgenic citrus plants

    • Test resistance to CiLV-C infection

  • Immune system modulation:

    • Identify plant varieties with enhanced HR to p61

    • Screen for resistance based on p61 recognition

    • Consider potential for extreme resistance vs. hypersensitive resistance

  • Small molecule inhibitors:

    • Screen for compounds that inhibit p61 function

    • Test for antiviral activity in plant-based assays

    • Develop structure-activity relationships

  • Vector management integration:

    • Combine p61-based approaches with mite control strategies

    • Consider ecological implications of resistance deployment

    • Develop integrated management approaches

  • Methodological framework:

    • Begin with proof-of-concept studies in model plants

    • Progress to greenhouse trials with citrus

    • Conduct field trials with appropriate biosafety measures

    • Monitor for resistance durability and potential virus adaptation

The understanding of p61's dual role in both suppressing RNA silencing and triggering defense responses provides a unique opportunity to develop targeted control strategies that exploit the delicate balance between virus virulence and plant immunity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.