Recombinant Citrus maxima Flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase (C12RT1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
C12RT1; CM12RHAT; Flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase; 1,2 rhamnosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-452
Protein Length
full length protein
Species
Citrus maxima (Pomelo) (Citrus grandis)
Target Names
C12RT1
Target Protein Sequence
MDTKHQDKPSILMLPWLAHGHIAPHLELAKKLSQKNFHIYFCSTPNNLQSFGRNVEKNFS SSIQLIELQLPNTFPELPSQNQTTKNLPPHLIYTLVGAFEDAKPAFCNILETLKPTLVMY DLFQPWAAEAAYQYDIAAILFLPLSAVACSFLLHNIVNPSLKYPFFESDYQDRESKNINY FLHLTANGTLNKDRFLKAFELSCKFVFIKTSREIESKYLDYFPSLMGNEIIPVGPLIQEP TFKEDDTKIMDWLSQKEPRSVVYASFGSEYFPSKDEIHEIASGLLLSEVNFIWAFRLHPD EKMTIEEALPQGFAEEIERNNKGMIVQGWVPQAKILRHGSIGGFLSHCGWGSVVEGMVFG VPIIGVPMAYEQPSNAKVVVDNGMGMVVPRDKINQRLGGEEVARVIKHVVLQEEAKQIRR KANEISESMKKIGDAEMSVVVEKLLQLVKKSE
Uniprot No.

Target Background

Function

Involved in the biosynthesis of the bitter neohesperidosides in citrus. Exhibits strict specificity for UDP-rhamnose as the donor substrate.

Database Links

KEGG: ag:AAL06646

Protein Families
UDP-glycosyltransferase family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in young fruits and leaves.

Q&A

Basic Research Questions

What is the biochemical role of C12RT1 in citrus flavonoid biosynthesis?

C12RT1 catalyzes the rhamnosylation of flavanone 7-O-glucosides to form flavanone disaccharides, a critical step in citrus flavonoid diversification . This enzyme transfers a rhamnose moiety from UDP-rhamnose to the 2''-position of the glucose group attached to flavanones, producing nonbitter rutinosides (e.g., narirutin) or bitter neohesperidosides depending on substrate specificity . Methodologically, its activity is confirmed via in vitro assays using recombinant protein and HPLC-MS to analyze products .

How is C12RT1 activity experimentally detected and quantified?

Key protocols include:

  • Recombinant protein expression: Heterologous expression in E. coli or yeast systems with affinity tag purification .

  • Enzyme assays: Incubation of purified C12RT1 with substrates (e.g., naringenin-7-O-glucoside) and UDP-rhamnose, followed by HPLC-MS to detect rhamnosylated products .

  • Kinetic analysis: Measurement of K<sub>m</sub> and k<sub>cat</sub> values using varying substrate concentrations under optimized pH (6.0–7.5) and temperature (30–37°C) .

How does C12RT1 function differ across Citrus species?

Functional divergence is observed in substrate specificity:

ParameterC. maxima (C12RT1)C. paradisi 1,2RhaT
Preferred substrateHesperetin-7-O-glucosideNaringenin-7-O-glucoside
K<sub>m</sub> (μM)12.9 (H7G)11.7 (N7G)
k<sub>cat</sub> (s<sup>-1</sup>)0.180.28
Data derived from kinetic studies show species-specific catalytic efficiencies influenced by structural variations in the active site .

Advanced Research Questions

What experimental strategies resolve contradictions in C12RT1 substrate specificity reports?

Discrepancies arise from:

  • Tissue-specific isoforms: Transient overexpression in pummelo leaves vs. in vitro assays may yield differing activities due to post-translational modifications .

  • Allelic variations: Type A alleles of 1,6RhaT genes (e.g., CgUGT89AK1) show functional activity, while B/C types are nonfunctional . Validate via allele-specific CRISPR editing or chimeric protein studies.

  • Co-factor requirements: NADPH enhances rhamnosylation in cell-free extracts, suggesting auxiliary metabolic interactions .

How can C12RT1 be engineered to modulate flavonoid profiles for metabolic studies?

Approaches include:

  • Site-directed mutagenesis: Target residues in the PSPG motif (e.g., W352, Q354) to alter UDP-sugar binding specificity .

  • Promoter-swapping: Use tissue-specific promoters (e.g., fruit peel-specific) in transgenic citrus to study spatial regulation of flavonoid biosynthesis .

  • Multi-enzyme cascades: Co-express C12RT1 with upstream glucosyltransferases (e.g., CgUGT89AK1) in N. benthamiana for pathway reconstitution .

What role does C12RT1 play in citrus-pathogen interactions?

C12RT1-derived flavanones are implicated in Huanglongbing (HLB) resistance. HLB-infected pummelo shows upregulated CitUGT89AK1 (a glucosyltransferase upstream of C12RT1) and increased flavanone glycosides, suggesting a defense-oriented metabolic shift . Methodological validation involves:

  • Pathogen challenge assays: Quantify C12RT1 expression (qRT-PCR) and flavonoid accumulation (LC-MS) post-Candidatus Liberibacter infection .

  • RNAi silencing: Knock down C12RT1 in citrus to assess susceptibility phenotypes .

Methodological Considerations Table

ChallengeSolutionKey Reference
Low recombinant protein solubilityUse truncated constructs (e.g., 1-452 aa) with solubility tags
Substrate competition in assaysPre-incubate with UDP-glucose to block side reactions
Distinguishing rutinosides/neohesperidosidesEmploy HILIC chromatography with MS/MS fragmentation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.