Recombinant Citrus sinensis ATP synthase subunit a, chloroplastic (atpI)

What is the functional role of ATP synthase subunit a, chloroplastic (atpI) in Citrus sinensis?

ATP synthase subunit a (atpI) is a critical component of the F0 sector in the chloroplastic ATP synthase complex of Citrus sinensis. This transmembrane protein of approximately 25 kDa belongs to the stator part of ATP synthase and plays an essential role in proton translocation across the thylakoid membrane . The protein forms part of the proton channel that allows H+ ions to flow down their electrochemical gradient from the thylakoid lumen to the stroma, which drives the rotation of the c-ring rotor. This mechanical energy is then converted into chemical energy in the form of ATP by the F1 catalytic domain .

In Citrus sinensis, the chloroplastic ATP synthase demonstrates particularly important functions during stress responses, including pathogen infections such as huanglongbing (HLB) caused by Candidatus Liberibacter asiaticus (CLas) . During such infections, alterations in atpI expression and ATP production have been observed to correlate with disease progression and symptom severity .

How can researchers differentiate between chloroplastic ATP synthase and mitochondrial ATP synthase in experimental designs?

When designing experiments to study chloroplastic ATP synthase specifically, researchers should consider:

Organelle isolation approach:

• Chloroplastic ATP synthase: Use differential centrifugation with buffers containing sorbitol (0.33 M) and HEPES (50 mM, pH 7.5) for chloroplast isolation

• Mitochondrial ATP synthase: Employ Percoll gradient centrifugation with mannitol/sucrose buffers

Molecular markers for verification:

• Chloroplastic ATP synthase: Confirm using antibodies against the CF1 alpha subunit (55.45 kDa)

• Mitochondrial ATP synthase: Verify using antibodies against mitochondrial ATP synthase beta subunit

Structural differences:

• c-ring composition: Chloroplastic ATP synthase typically contains 14 c-subunits versus 8-10 in mitochondrial ATP synthase

• Redox regulation: Chloroplastic ATP synthase contains unique redox-sensitive regulatory elements absent in mitochondrial ATP synthase

Subcellular localization:

• Chloroplastic ATP synthase: Localized in thylakoid membranes

• Mitochondrial ATP synthase: Found in inner mitochondrial membranes

Functional assays:

• Light-dependent assays (specific for chloroplastic): Measure ATP production under varying light conditions

• Inhibitor specificity: Tentoxin inhibits chloroplastic but not mitochondrial ATP synthase

What are the structural characteristics of recombinant Citrus sinensis atpI protein?

Recombinant Citrus sinensis ATP synthase subunit a, chloroplastic (atpI) is characterized by:

Primary structure:

• Full protein length: 247 amino acids

• Molecular weight: Approximately 25 kDa

• Amino acid sequence (partial): MNVLSCSMNTLRGLYDISGVEVGQHFYWQIGGFQVHAQVLITSWVVIAILLGSAFIAVRN PQTVPTATQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWKII ELPHGELAAPTNDINTTVALALLTSIAYFYAGLSKKGLGYFSKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Structural elements:

• Contains multiple transmembrane helices forming proton-conducting channels

• Includes hydrophobic regions critical for membrane insertion

• Features conserved acidic residues necessary for proton translocation

Comparative structure:
Table 1: Comparison of atpI proteins across species

What expression systems are most effective for producing recombinant Citrus sinensis atpI protein?

Based on current research methodologies, the following expression systems have proven effective for recombinant Citrus sinensis atpI:

E. coli expression system:

• Vector recommendation: pET series vectors with N-terminal His-tag fusion

• Strain selection: BL21(DE3) or Rosetta(DE3) for rare codon optimization

• Induction conditions: 0.5 mM IPTG at 18°C for 16-20 hours to minimize inclusion body formation

• Solubility enhancement: Co-expression with molecular chaperones (GroEL/GroES)

• Purification strategy: Immobilized metal affinity chromatography using Ni-NTA resin, followed by size exclusion chromatography

Plant-based expression systems:

• Transient expression: Agrobacterium-mediated expression in Nicotiana benthamiana leaves

• Stable transformation: Agrobacterium-mediated transformation of Arabidopsis for functional studies

Expression optimization parameters:

• Codon optimization for target expression system

• Addition of transit peptide sequences for proper organelle targeting in plant systems

• Temperature and time optimization to balance yield and proper folding

Reconstitution approach:

• Liposome reconstitution using soybean phospholipids (70% phosphatidylcholine, 30% phosphatidylethanolamine)

• Detergent-mediated reconstitution using n-dodecyl-β-D-maltoside followed by detergent removal

How does ATP synthase expression and activity correlate with citrus huanglongbing (HLB) disease progression?

Studies examining the relationship between ATP synthase and HLB have revealed significant correlations:

Expression pattern changes:

• ATP synthase subunit expression is significantly altered during CLas infection

• The gene expression of chloroplast ATP synthase beta-subunits is upregulated over fivefold in CLas-infected citrus leaves

• Mitochondrial ATP synthase components show similar upregulation patterns

ATP accumulation dynamics:

• ATP levels show a significant increase in CLas-infected citrus leaves compared to healthy counterparts

• Luminescence measurements of approximately 15,000 CPS in Las-infected symptomatic leaves indicate substantially elevated ATP levels

• ATP accumulation correlates directly with HLB symptom severity

Temporal relationship between ATP and H2O2:

• As ATP and H2O2 concentrations increase in leaves, HLB symptom severity also increases

• This trend remains consistent across different citrus varieties (grapefruit, sweet orange, sour orange, and lemon)

Variety-specific responses:
Table 2: ATP Synthase Expression Changes in Different Citrus Varieties during CLas Infection

These findings suggest that CLas may manipulate the plant's ATP production to create a nutrient-rich environment that benefits bacterial proliferation .

What methodologies are most effective for studying the role of ATP synthase in plant defense responses?

To effectively study ATP synthase's role in plant defense responses, researchers should consider the following methodologies:

Transcriptomic approaches:

• RNA-Seq analysis to identify differential expression of ATP synthase genes during pathogen infection

• Real-time qPCR validation of ATP synthase subunit expression using gene-specific primers

• Comparison with other stress-related genes (e.g., RBOH, APX, SOD) to establish regulatory networks

Proteomic and biochemical analyses:

• Western blot analysis using antibodies specific to ATP synthase subunits

• Co-immunoprecipitation to identify interacting proteins during defense responses

• ATP measurement using luciferase-based assays to quantify ATP production

• Enzyme activity assays to measure ATP synthase functionality during stress

Functional genomics tools:

• CRISPR/Cas9-mediated gene editing to create atpI knockout or knockdown lines

• Overexpression studies using constitutive or inducible promoters

• Agrobacterium-mediated transient expression for rapid functional validation

Microscopy and subcellular localization:

• Confocal microscopy using fluorescent protein fusions to track ATP synthase localization during infection

• Transmission electron microscopy to observe structural changes in chloroplast membranes and ATP synthase complexes

Metabolomic integration:

• Comprehensive metabolite profiling to link ATP production with downstream metabolic changes

• Focus on energy-dependent defense compounds and signaling molecules

• Correlation of ATP/ADP ratios with ROS production and antioxidant enzyme activities

What mechanisms explain the paradoxical increase of both ATP and H2O2 in Citrus sinensis during CLas infection?

The simultaneous increase of both ATP and H2O2 in CLas-infected citrus presents an apparent paradox that can be explained through several interconnected mechanisms:

Altered redox homeostasis model:

• CLas effectors target both mitochondria and chloroplasts, disrupting normal electron transport chains

• Electron leakage from disrupted transport chains leads to increased ROS (particularly H2O2) production

• Research shows that CLas infection upregulates respiratory burst oxidase homologs (RBOH) , which generate H2O2 as part of the plant defense response

Compensatory ATP production pathways:

• Upregulation of ATP synthase gene expression (>5-fold increase) represents a compensatory response to energy demands during infection

• Alternative respiratory pathways may be activated to maintain ATP production despite oxidative damage

Impaired ROS scavenging systems:

• Downregulation of H2O2 detoxification enzymes during infection:

  • Ascorbate peroxidase (APX) was downregulated approximately 30-fold across four citrus varieties tested

  • Catalase (CAT) and other enzymatic antioxidants show similar suppression

• This enzymatic imbalance permits H2O2 accumulation despite increased ATP production

Direct pathogen manipulation:

• CLas effectors may directly target ATP synthase to create an energy-rich environment for bacterial proliferation

• Recent research has identified CLas effector proteins that interact with host proteins involved in both energy metabolism and ROS homeostasis

• For example, effector CLas0185 targets methionine sulphoxide reductase B1 (CsMsrB1) which affects ascorbate peroxidase 1 (CsAPX1) activity and H2O2 accumulation

Experimental evidence for relationship:
Table 3: Relationship Between Symptom Severity, ATP and H2O2 Levels in CLas-infected Citrus

This paradoxical relationship demonstrates how CLas infection disrupts the normal balance between energy production and ROS metabolism, potentially benefiting pathogen survival at the expense of host cell integrity.

What approaches can be used to engineer chloroplastic ATP synthase in Citrus sinensis for enhanced disease resistance?

Engineering chloroplastic ATP synthase for enhanced disease resistance requires sophisticated approaches targeting various aspects of protein function and regulation:

Structure-based protein engineering:

• Site-directed mutagenesis of key residues in the atpI proton channel to alter proton translocation efficiency

• Modification of regulatory domains to enhance activity during pathogen attack

• Introduction of stabilizing mutations to maintain function under oxidative stress

Redox regulation enhancement:

• Engineering of redox-sensitive switches to maintain ATP synthase activity during infection

• Targeting the β-hairpin redox switch in subunit γ that regulates activity in response to light/dark conditions

• Creating oxidation-resistant variants of ATP synthase that maintain function despite elevated ROS

Transgenic approaches:

• Development of synthetic promoters for pathogen-inducible expression of ATP synthase genes

• Co-expression with ROS-scavenging enzymes to create a coordinated defense response

• CRISPR/Cas9-mediated editing to create variants with optimized activity during stress

Novel protein-protein interactions:

• Engineering ATP synthase to disrupt interactions with pathogen effectors

• Creating fusion proteins that link ATP synthase regulation with defense signaling pathways

• Implementing decoy strategies where modified ATP synthase subunits act as molecular traps for pathogen effectors

Experimental workflow:

• Computational modeling to identify target sites for modification

• In vitro validation using recombinant proteins and biochemical assays

• Transient expression in model systems (e.g., Nicotiana benthamiana)

• Stable transformation of citrus using Agrobacterium-mediated methods

• Phenotypic and molecular characterization under control and infected conditions

Challenges and considerations:

• Maintaining proper assembly of the ATP synthase complex

• Avoiding disruption of essential energy metabolism

• Ensuring tissue-specific and developmentally appropriate expression

• Addressing potential trade-offs between enhanced defense and growth/yield

How do post-translational modifications of ATP synthase subunit a affect its function during pathogen infection?

Post-translational modifications (PTMs) of ATP synthase subunit a play crucial roles in regulating enzyme function during pathogen infection:

Phosphorylation dynamics:

• Phosphorylation sites in the N-terminal and C-terminal regions modulate protein-protein interactions

• Stress-responsive kinases target ATP synthase during infection, altering proton channel function

• Phosphoproteomic studies have identified multiple phosphorylation sites in subunit a that change in response to pathogen elicitors

Redox-based modifications:

• Cysteine residues undergo oxidation/reduction in response to changing ROS levels

• These modifications can temporarily inhibit ATP synthase activity to prevent excessive ROS production

• Site-specific mutations of key cysteine residues can alter pathogen susceptibility

Glycosylation patterns:

• N-linked glycosylation contributes to protein stability during stress conditions

• Altered glycosylation has been observed in ATP synthase components during CLas infection

• Glycosylation may protect against proteolytic degradation during the defense response

Proteolytic processing:

• Controlled proteolysis of ATP synthase subunits can regulate complex assembly

• Some pathogen effectors may target proteolytic sites to manipulate host energy production

• Engineering protease-resistant variants could maintain ATP production during infection

Experimental detection methods:

• Mass spectrometry-based approaches for comprehensive PTM mapping

• Site-specific antibodies to monitor particular modifications

• Functional assays comparing wild-type and mutation-mimicking variants

Regulatory significance during infection:
Table 4: Key Post-translational Modifications of ATP Synthase During Pathogen Infection

Understanding these modifications provides opportunities for engineering ATP synthase variants with optimal function during pathogen attack and enhanced contribution to defense responses.

What is the relationship between ATP synthase activity and ROS-mediated defense signaling in Citrus-CLas interactions?

The relationship between ATP synthase activity and ROS-mediated defense signaling in Citrus-CLas interactions involves complex bidirectional regulation:

ROS production mechanisms:

• H2O2 accumulation during CLas infection results from upregulation of respiratory burst oxidase homologs (RBOH)

• ATP synthase dysfunction can contribute to electron leakage and superoxide production

• Studies show CLas infection increases both ATP and H2O2 concentrations, with symptom severity positively correlating with both molecules

ATP-dependent ROS signaling pathways:

• ATP is required for RBOH activation and sustained ROS production

• ATP-dependent protein kinases phosphorylate RBOHs, enhancing their activity

• ATP synthase upregulation (>5-fold) during infection provides energy for defense responses

Feedback regulation mechanisms:

• H2O2 can modify ATP synthase through oxidation of critical cysteine residues

• Prolonged oxidative stress impairs ATP synthase function through lipid peroxidation of thylakoid membranes

• Altered electron transport affects the proton gradient required for ATP synthesis

Defense signaling integration:

• ATP acts as a damage-associated molecular pattern (DAMP) when released extracellularly

• ATP-dependent phosphorylation cascades activate transcription factors controlling defense genes

• ATP depletion can trigger programmed cell death as an ultimate defense response

Impact of CLas effectors:

• CLas effector CLas0185 targets CsMsrB1, which affects CsAPX1 activity and H2O2 accumulation

• This interaction promotes CLas proliferation by altering both ROS levels and energy metabolism

• Other effectors may directly target ATP synthase components or their regulators

Temporal dynamics of the interaction:
Table 5: Temporal Relationship Between ATP Synthase, ROS, and Defense Responses During CLas Infection

This relationship reveals how CLas infection creates a vicious cycle where increased ATP production supports both defense responses and pathogen multiplication, while sustained ROS accumulation gradually damages host tissues, manifesting as HLB symptoms.

How can recombinant Citrus sinensis atpI be utilized as a tool for screening potential HLB therapeutic compounds?

Recombinant Citrus sinensis ATP synthase subunit a (atpI) offers valuable applications for screening HLB therapeutic compounds:

High-throughput screening platforms:

• Development of ATP synthase activity assays using purified recombinant atpI

• Incorporation into liposomes for membrane-associated functional studies

• Fluorescence-based assays measuring proton translocation efficiency

Compound screening methodology:

• Expression and purification of recombinant atpI protein

• Reconstitution into proteoliposomes with complete ATP synthase complex

• Establishment of baseline enzymatic activity parameters

• Screening compounds for:

  • Protection of ATP synthase activity under oxidative stress

  • Modulation of ATP production during simulated infection conditions

  • Interference with pathogen effector-ATP synthase interactions

Applications in therapeutic development:

• Identification of compounds that preserve ATP synthase function during infection

• Discovery of molecules that block CLas effector interactions with ATP synthase

• Development of treatments that restore normal ATP/ROS balance in infected tissues

Validation protocol:

• Primary screening: In vitro biochemical assays with recombinant protein

• Secondary screening: Citrus cell cultures expressing fluorescently-tagged ATP synthase

• Tertiary screening: Greenhouse trials with CLas-infected citrus plants

• Field validation: Controlled studies in infected orchards

Emerging therapeutic targets:
Table 6: Potential Therapeutic Approaches Targeting ATP Synthase in HLB Management

This approach leverages recombinant atpI as a molecular tool for understanding disease mechanisms and identifying intervention points for HLB management strategies.

What research directions could address the conflicting findings between studies on ATP synthase expression during CLas infection?

Several studies have reported contradictory findings regarding ATP synthase expression and activity during CLas infection. These research directions could help resolve these discrepancies:

Standardized experimental approaches:

• Development of reference methods for tissue sampling, RNA extraction, and protein isolation

• Establishment of standardized quantification protocols for ATP synthase activity

• Creation of a common set of reference genes for expression normalization

Temporal resolution studies:

• Fine-grained time-course experiments from initial infection through symptom development

• Correlation of ATP synthase expression changes with bacterial titer

• Investigation of oscillatory patterns that might be missed in endpoint studies

Citrus variety-specific responses:

• Comprehensive comparison across commercial and wild citrus varieties

• Analysis of ATP synthase sequence and regulatory variations between resistant and susceptible varieties

• Examination of variety-specific post-translational modifications

Environmental interaction effects:

• Study of how environmental conditions modify ATP synthase responses to infection

• Investigation of seasonal variations in ATP/ROS relationships

• Analysis of how abiotic stressors (temperature, drought) affect CLas-induced ATP synthase changes

Tissue-specific expression patterns:

• Comparison of responses in different tissues (leaves, stems, roots)

• Microdissection studies to examine phloem-specific changes

• Single-cell transcriptomics to resolve cellular heterogeneity in infected tissues

Methodological considerations for conflicting results:
Table 7: Factors Contributing to Contradictory Findings in ATP Synthase Research

Addressing these factors through rigorous experimental design and collaborative research networks would help resolve current contradictions and establish a unified model of ATP synthase function during CLas infection.

How might genetic diversity in Citrus sinensis ATP synthase contribute to variable HLB susceptibility?

Genetic diversity in Citrus sinensis ATP synthase may significantly influence HLB susceptibility through several mechanisms:

Sequence variation analysis:

• Comparison of atpI sequences across citrus varieties with different HLB susceptibility

• Identification of single nucleotide polymorphisms (SNPs) in critical functional domains

• Analysis of allelic diversity in wild citrus species for potential resistance traits

Structural impacts of genetic variation:

• Modeling of how amino acid substitutions affect proton channel structure

• Investigation of changes in protein-protein interactions within the ATP synthase complex

• Analysis of how variants impact interactions with CLas effector proteins

Regulatory element diversity:

• Characterization of promoter variations affecting expression levels

• Identification of alterations in RNA processing signals influencing transcript stability

• Analysis of epigenetic modifications affecting ATP synthase gene expression

Functional consequences of diversity:

• Biochemical characterization of ATP synthase variants from resistant and susceptible varieties

• Measurement of enzymatic efficiency, ROS tolerance, and stability under stress

• Assessment of how variants respond to CLas effector proteins

Evolutionary aspects:

• Phylogenetic analysis of ATP synthase across Citrus species and related genera

• Identification of selection pressures on ATP synthase genes throughout citrus evolution

• Investigation of whether ancient exposure to related pathogens has selected for resistant variants

Diversity assessment and breeding implications:
Table 8: ATP Synthase Diversity and HLB Susceptibility Correlations