Recombinant Citrus sinensis Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Introduction to Citrus sinensis Chloroplast Envelope Membrane Protein (cemA)

The Chloroplast envelope membrane protein (cemA) is an essential component of the chloroplast genome in Citrus sinensis (sweet orange), one of the world's most economically important fruit crops. The protein plays a crucial role in chloroplast function and homeostasis. The complete chloroplast genome of Citrus sinensis has been sequenced and characterized as a nonrecombining circular unit of 160,129 bp length containing 133 genes (89 protein-coding, 4 rRNAs, and 30 distinct tRNAs) . Within this genomic context, the cemA gene encodes a protein with specific functions related to ion transport and chloroplast membrane processes.

Protein Identification and Classification

The cemA protein from Citrus sinensis is registered in the UniProt database with the accession number Q09MG6 . It is classified as an envelope membrane protein in the chloroplast, with specific functional roles in membrane transport processes .

Location in the Chloroplast Genome

The cemA gene is one of the protein-coding genes located within the large single copy (LSC) region of the Citrus sinensis chloroplast genome . In comparative genomic studies of chloroplast genomes, the cemA gene has been identified as part of the functional category of proteins involved in "other functions," specifically as an envelope membrane protein .

Genetic Variation and Polymorphisms

Studies examining genetic variations in chloroplast genomes have revealed that the cemA gene may be affected by insertions and deletions (indels). In Citrus species, cemA is one of several genes where indels have been detected that could affect the coding region . These indels may lead to functional variations of the protein across different citrus species and varieties, making this gene important for phylogenetic studies and understanding chloroplast genome evolution.

GeneIndel Density (indels per kb)
atpF4.4
cemA2.9
rpoC12.2
Average in coding regions0.5

Table 1: Indel density in selected chloroplast genes including cemA compared to the average in coding regions

Potassium/Proton Antiport Activity

According to the UniProt database, the Citrus sinensis cemA protein contributes to potassium/hydrogen (K+/H+) antiport activity by supporting proton efflux to control proton extrusion and homeostasis in chloroplasts . This function is critically important and operates in a light-dependent manner, suggesting its involvement in photosynthesis-related processes.

Significance in Chloroplast Function

The ion transport function of cemA is essential for maintaining proper ionic balance and pH within the chloroplast compartment. This homeostasis is crucial for various chloroplast functions, including photosynthetic efficiency and metabolic processes within the organelle. The light-dependent nature of its activity indicates its integration with the photosynthetic machinery of the plant cell .

Production Parameters

Recombinant Citrus sinensis cemA protein is produced for research applications through expression systems that can generate the protein with high purity and in sufficient quantities. The commercial recombinant protein is typically expressed for the full length of the protein (amino acids 1-234) .

Applications in Chloroplast Biology

Recombinant cemA protein serves as a valuable tool for studying chloroplast membrane functions, particularly ion transport mechanisms and their regulation in response to light and other environmental factors. As a K+/H+ antiporter component, it provides insights into the mechanisms of pH regulation and ion homeostasis in chloroplasts.

Relevance to Citrus Research

Citrus species are subject to various environmental stresses that can impact their growth, development, and yield . Understanding the function of chloroplast proteins like cemA contributes to our knowledge of how these plants respond to and adapt to environmental challenges. Recent studies have identified various gene families in Citrus sinensis that play roles in stress responses , and chloroplast proteins like cemA may interact with these pathways.

Phylogenetic Studies

The cemA gene, as part of the chloroplast genome, has been used in phylogenetic analyses to elucidate the relationships among Citrus species and cultivars . These studies help clarify the evolutionary history and genetic relationships within the Citrus genus, which has both taxonomic significance and practical implications for citrus breeding and improvement.

Role in Stress Responses

Given the importance of chloroplast function in plant responses to environmental stresses, investigating the role of cemA in citrus stress responses presents an important research direction. Studies examining how cemA expression and function change under different stress conditions could provide insights into potential strategies for improving citrus stress tolerance.

Applications in Citrus Improvement

The recombinant cemA protein and knowledge of its gene could potentially contribute to strategies for citrus improvement. As genome editing technologies become more refined for application in citrus species , understanding the function of individual genes like cemA becomes increasingly valuable for targeted approaches to enhance desirable traits or stress resistance.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customer use.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-234
Protein Length
full length protein
Species
Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis)
Target Names
cemA
Target Protein Sequence
MTKKNASIPLRYLSSIVFVVFLPWWIPLSFNKSLESWVTNWWNTSQSETFLNDIQEKAIL EKFIELEELFLLDEMIKEFPERRLEKLRIGLQKETIQLIKMHDEDHIHTIFHFSTNTICF VILSGYSILCNEELFILNSWVQEFLYNLSDTIKAFSILFVTDLCIGFHSPRGWELLIGYV YNDFGLAHNDNDIILSVLVSTFPVVLDTFFKYWLFSYLNRVSPSLVVIYHSMTE
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly facilitates efficient inorganic carbon uptake into chloroplasts.
Database Links

KEGG: cit:4271217

Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.