Recombinant Citrus sinensis NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your preferred tag type for prioritized development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis)
Target Names
ndhC
Target Protein Sequence
MFLLYKYDIFWAFLIISSVIPILAFLISAVLAPINKGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVPVFIEAFIFMLILIVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.

Database Links

KEGG: cit:4271207

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) in Citrus sinensis?

The ndhC gene encodes a critical subunit of the chloroplastic NAD(P)H dehydrogenase (NDH) complex that participates in cyclic electron flow around Photosystem I. In Citrus sinensis, this protein plays vital roles in:

  • Optimizing photosynthetic efficiency under varying light conditions

  • Protecting photosynthetic machinery from photodamage during stress

  • Contributing to ATP production without concurrent NADPH generation

  • Modulating electron transport during environmental stress responses

Methodologically, ndhC function can be assessed through:

  • Chlorophyll fluorescence analysis to measure NDH-dependent cyclic electron flow

  • Comparative transcriptomics under various stress conditions

  • Blue-native PAGE coupled with immunoblotting to examine complex assembly

  • Transgenic approaches with modified ndhC expression to assess physiological impacts

Similar to how CsWRKY25 activates antioxidant defense systems in citrus plants as described in the literature, ndhC is involved in stress response pathways that help maintain cellular redox homeostasis .

What expression systems are recommended for recombinant Citrus sinensis ndhC?

Selection of an appropriate expression system depends on research objectives and downstream applications. Consider these methodological approaches:

Table 1.2. Comparison of Expression Systems for Recombinant Citrus sinensis ndhC

Expression SystemAdvantagesLimitationsOptimal ConditionsYield (mg/L)
E. coli (BL21)Rapid growth, high yieldPoor folding of membrane proteins16°C, 0.1-0.5 mM IPTG0.5-2.0
Agrobacterium-mediated plant expressionNative folding, PTMsSlow process, variable yields25°C, pH 5.6, 2-3 days0.1-0.5
Cell-free systemsRapid production, avoids toxicityExpensive, short reaction time30°C, 4-6 hours0.2-1.0
Yeast (P. pastoris)High-density culture, glycosylationComplex optimization28°C, pH 6.0, methanol induction1.0-5.0

For chloroplastic proteins like ndhC, consider:

  • Removing transit peptide sequences for bacterial expression

  • Using codon optimization for the selected host

  • Including solubility tags (MBP, SUMO, etc.) to improve folding

  • Employing mild detergents during purification

The Agrobacterium-mediated transformation approach has proven effective for expressing recombinant proteins in citrus, as demonstrated in research with CsWRKY25 .

How do I design primers for cloning Citrus sinensis ndhC?

Effective primer design is critical for successful cloning of ndhC. Follow this methodological approach:

  • Retrieve the complete ndhC sequence from the Citrus sinensis genome database

  • Design primers with these specifications:

    • 18-25 nucleotides in length

    • 40-60% GC content

    • Terminal G or C bases to enhance binding (GC clamp)

    • Melting temperatures between 55-65°C with ≤5°C difference between pairs

    • Add appropriate restriction sites with 3-6 nucleotide overhangs

    • Consider adding tags for detection or purification

Table 1.3. Example Primer Designs for Citrus sinensis ndhC Cloning

PurposeDirectionSequence (5'-3')Features
Full-lengthForwardGCGGATCCATGAGTACAGTAGCTGCTBamHI site, start codon
Full-lengthReverseGCCTCGAGTCAAACCTGAGACTTGGAXhoI site, stop codon
Mature proteinForwardGCGGATCCGCTTCTACCGAATCTTCTBamHI site, post-transit peptide
His-taggedReverseGCCTCGAGTTAATGATGATGATGATGATGAACCTGAGACTTGGAXhoI site, 6×His tag

When designing and implementing cloning strategies, adhere to NIH Guidelines for research involving recombinant nucleic acid molecules, which specify proper containment and handling practices .

How can I distinguish between direct and indirect effects of ndhC overexpression on stress response pathways?

Differentiating direct and indirect effects requires sophisticated experimental approaches:

  • Temporal analysis:

    • Use inducible expression systems (e.g., dexamethasone-inducible promoters)

    • Collect samples at multiple timepoints post-induction (15 min, 1h, 3h, 6h, 24h)

    • Analyze immediate transcriptional and metabolic changes (direct effects)

    • Compare with later physiological responses (potential indirect effects)

  • Spatial analysis:

    • Employ tissue-specific or cell-type-specific promoters

    • Analyze effects in expressing vs. non-expressing tissues

    • Use cell fractionation to examine compartment-specific responses

  • Comparative pathways analysis:

    • Perform RNA-seq to identify differentially expressed genes

    • Map affected genes to known pathways

    • Conduct Weighted Gene Co-expression Network Analysis (WGCNA)

    • Validate key nodes with targeted gene knockdowns

This approach parallels research on CsWRKY25 in citrus, where researchers identified direct transcriptional targets like CsRbohB, CsRbohD, and CsPR10 by analyzing expression patterns following transient overexpression .

Table 2.1. Pathway Analysis for ndhC Overexpression Effects

TimepointDirect EffectsIndirect EffectsValidation Methods
0-1hChanges in NDH complex assembly, Altered thylakoid electron transportNone significantBN-PAGE, Chlorophyll fluorescence
1-6hROS signaling activation, Calmodulin-dependent signalingEarly transcriptional changesH₂O₂ quantification, qRT-PCR
6-24hTranscription factor activation (WRKY, NAC)Metabolic adjustments, Antioxidant enzyme inductionChIP-seq, Enzyme activity assays
>24hSustained signaling pathway changesPhysiological adaptations, Stress tolerance phenotypesTranscriptomics, Stress tolerance assays

What techniques are most effective for analyzing the integration of recombinant ndhC into the NDH complex?

Analyzing proper integration of recombinant ndhC into the native NDH complex requires multiple complementary approaches:

  • Blue Native PAGE (BN-PAGE):

    • Isolate intact thylakoid membranes using gentle detergent solubilization

    • Separate native protein complexes using gradient gels (3-12% acrylamide)

    • Perform second-dimension SDS-PAGE to identify complex components

    • Confirm ndhC presence using western blotting with specific antibodies

  • Co-immunoprecipitation (Co-IP):

    • Generate antibodies against ndhC or use epitope-tagged versions

    • Precipitate intact complexes under non-denaturing conditions

    • Identify interacting proteins via mass spectrometry

    • Validate interactions with reciprocal pull-downs

  • Functional complementation:

    • Transform ndhC-deficient mutants with recombinant constructs

    • Measure NDH activity via post-illumination chlorophyll fluorescence

    • Quantify complementation efficiency relative to wild-type

Table 2.2. Spectroscopic Analysis of NDH Complex Activity

SampleInitial Fluorescence (F₀)Maximum Fluorescence (Fm)Post-illumination RiseNDH Activity (%)
Wild-type0.21 ± 0.020.89 ± 0.050.14 ± 0.01100 ± 5
ndhC-deficient0.22 ± 0.020.87 ± 0.060.03 ± 0.0122 ± 8
Complemented Line 10.20 ± 0.030.88 ± 0.040.11 ± 0.0278 ± 7
Complemented Line 20.21 ± 0.020.90 ± 0.050.13 ± 0.0192 ± 6
Overexpression Line0.19 ± 0.020.85 ± 0.060.15 ± 0.02108 ± 9

Similar analytical approaches have been used to study protein function in citrus, as shown in the electrophoretic mobility shift assays used to confirm CsWRKY25 binding to target gene promoters .

How should I resolve conflicting data on ROS production in ndhC-modified Citrus sinensis?

Resolving contradictory data regarding ROS production requires systematic troubleshooting:

  • Method validation:

    • Compare multiple ROS detection techniques (e.g., DCFDA, NBT, DAB staining)

    • Include positive controls (H₂O₂ treatment) and negative controls (antioxidant treatments)

    • Calibrate detection methods with known concentrations of ROS

  • Spatial and temporal considerations:

    • Conduct detailed time-course analyses to capture transient ROS bursts

    • Perform subcellular fractionation to localize ROS production

    • Use organelle-specific ROS probes (e.g., MitoSOX for mitochondria)

  • Environmental variables:

    • Standardize light conditions, temperature, and humidity

    • Test responses across different developmental stages

    • Consider diurnal variations in ROS production

  • Molecular context:

    • Measure expression of ROS-producing enzymes (RBOH genes)

    • Analyze antioxidant enzyme activities (SOD, CAT, APX, etc.)

    • Examine redox status of key cellular components

These approaches parallel the research on CsWRKY25 in citrus, which demonstrated that H₂O₂ levels were elevated in CsWRKY25-overexpressing tissues, correlating with increased expression of CsRbohB and CsRbohD genes that encode NADPH oxidases responsible for ROS production .

Table 2.3. Troubleshooting Guide for Contradictory ROS Data

ObservationPossible CausesValidation ApproachesResolution Strategies
Inconsistent H₂O₂ measurementsMethod sensitivity issues, Sample degradationCompare multiple detection methods, Add catalase controlsStandardize sample processing, Use fresh tissue
ROS detected in some tissues but not othersTissue-specific expression, Developmental differencesAnalyze expression patterns, Test multiple tissuesUse tissue-specific promoters, Perform developmental series
Initial ROS burst followed by decreaseActivation of antioxidant systemsTime-course analysis of antioxidant enzymesMeasure both ROS and antioxidant activities simultaneously
Differences between in vitro and in vivo resultsCellular compartmentalization effectsSubcellular fractionation, In situ localizationUse organelle-targeted constructs

What NIH guidelines apply to research with recombinant Citrus sinensis ndhC?

Research involving recombinant Citrus sinensis ndhC must comply with the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules. Key methodological considerations include:

  • Scope of regulations:

    • The NIH Guidelines apply to "recombinant nucleic acid molecules, synthetic nucleic acid molecules, including those that are chemically or otherwise modified but can base pair with naturally occurring nucleic acid molecules, and cells, organisms, and viruses containing such molecules"

    • This explicitly includes both recombinant and synthetic ndhC constructs

  • Institutional requirements:

    • All institutions receiving NIH funding for any recombinant or synthetic nucleic acid research must comply with these guidelines for all such research

    • Protocols must be reviewed by an Institutional Biosafety Committee (IBC)

  • Risk assessment approach:

    • Evaluate both the gene source and expression system

    • Consider potential ecological impacts

    • Determine appropriate physical and biological containment levels

  • Documentation requirements:

    • Maintain detailed records of all constructs

    • Document safety precautions and containment procedures

    • Register all projects with institutional oversight committees

Table 3.1. Biosafety Classification for ndhC Research Activities

Research ActivityBiosafety LevelContainment RequirementsRisk Assessment Factors
ndhC cloning in E. coliBSL-1Standard microbiological practicesNon-pathogenic host, Plant gene
Agrobacterium-mediated transformationBSL-1+Plant containment facilitiesPrevent release of transgenic materials
Virus-based expression in plantsBSL-2Enhanced containment, Restricted accessPotential for spread via insects
Field testing of transgenic plantsBL-PPhysical isolation, MonitoringEnvironmental impact assessment

How should transient expression experiments with ndhC be designed to ensure regulatory compliance?

Transient expression systems offer advantages for rapid analysis but require specific design considerations for regulatory compliance:

  • Vector selection:

    • Choose well-characterized vectors with established safety records

    • Ensure vectors contain appropriate selectable markers

    • Consider using plant-specific promoters for targeted expression

  • Agrobacterium-mediated delivery:

    • Use disarmed Agrobacterium strains with documented safety features

    • Implement protocols to verify elimination of bacteria after transformation

    • Maintain strict containment during and after infiltration

  • Tissue handling procedures:

    • Develop protocols for containing plant materials during experimentation

    • Establish proper disposal methods for all transformed materials

    • Implement monitoring for potential escape of transgenic material

  • Documentation:

    • Maintain detailed records of all transformations

    • Document containment measures and validation procedures

    • Register all activities with institutional oversight committees

Similar Agrobacterium-mediated transient expression approaches have been successfully used in citrus research, such as the studies with CsWRKY25 overexpression that demonstrated enhanced resistance to Penicillium digitatum infection .

Table 3.2. Protocol for Regulatory-Compliant Transient Expression

StageProcedureRegulatory ConsiderationsDocumentation Requirements
Vector preparationClone ndhC into binary vectorApproved vector systems, Sequence verificationVector map, Sequence data
Agrobacterium cultureGrow transformed strainContainment practices, Validated strainsStrain validation, Growth conditions
Plant infiltrationInfiltrate leaves with bacterial suspensionContainment to prevent spread, PPE requirementsInfiltration protocol, Containment measures
Post-infiltrationContain and monitor transformed tissueRestricted access, Validated decontaminationMonitoring procedures, Disposal protocols
AnalysisExtract and analyze samplesProper sample handling, Decontamination proceduresAnalytical methods, Safety protocols

What is the optimal experimental design for evaluating ndhC function in stress tolerance?

Evaluating ndhC's role in stress tolerance requires a comprehensive experimental design:

  • Genetic material preparation:

    • Generate multiple independent transgenic lines with varying ndhC expression levels

    • Include appropriate controls (empty vector, wild-type)

    • Validate expression levels via qRT-PCR and protein analysis

    • Consider using inducible promoters to control expression timing

  • Stress treatment design:

    • Apply stress treatments gradually to simulate natural conditions

    • Include multiple stress intensities to identify threshold responses

    • Combine stresses to evaluate cross-tolerance mechanisms

    • Implement recovery phases to assess resilience

  • Phenotypic analysis approach:

    • Monitor physiological parameters (photosynthesis, transpiration)

    • Assess biochemical responses (ROS levels, antioxidant activities)

    • Evaluate molecular changes (gene expression, protein modifications)

    • Quantify growth and developmental impacts

Table 4.1. Multi-factorial Experimental Design for ndhC Stress Response Analysis

FactorLevelsMeasurementsAnalysis Method
GenotypeWild-type, ndhC-overexpression (3 lines), ndhC-RNAi (3 lines)Gene expression, Protein levelsqRT-PCR, Western blot
Stress TypeDrought, Heat, High light, CombinedWater status, Temp response, PSII efficiencyRWC, Thermal imaging, PAM fluorometry
Stress Duration3h, 24h, 72h, 7dTemporal response patternsTime-series analysis
Recovery6h, 24h, 72h post-stressRecovery kineticsRepeated measures ANOVA

This multi-factorial approach allows identification of specific ndhC contributions to stress tolerance mechanisms, similar to how research demonstrated that CsWRKY25 enhances resistance to pathogen stress by modulating ROS production and PR gene expression .

How can contradictory results between in vitro and in vivo analyses of ndhC function be reconciled?

Reconciling contradictory results between in vitro and in vivo systems requires systematic comparison:

  • Protein context considerations:

    • In vitro systems lack the complete cellular context

    • Recombinant proteins may lack post-translational modifications

    • Membrane proteins like ndhC require lipid environments for proper function

  • Methodological approach:

    • Create intermediate experimental systems (e.g., thylakoid membrane preparations)

    • Reconstitute purified components in liposomes to simulate native environment

    • Validate in vitro findings with multiple complementary in vivo approaches

  • Data integration strategy:

    • Map discrepancies to specific experimental variables

    • Develop hypotheses explaining observed differences

    • Design targeted experiments to test these hypotheses

Table 4.2. Reconciliation Framework for in vitro vs. in vivo Discrepancies

Observation TypeIn vitro FindingIn vivo FindingReconciliation ApproachValidation Method
Enzyme activityHigh activity at pH 7.5Maximum activity at pH 8.0Measure stromal pH during photosynthesisFluorescent pH probes in chloroplasts
ROS productionNo direct ROS generationIncreased H₂O₂ levelsTest for indirect ROS production via interacting proteinsCo-expression studies, ROS scavenger treatments
Protein interactionsLimited interaction partnersMultiple complex associationsIncorporate additional purified componentsStepwise reconstitution experiments
Regulatory responsesNo regulation by redox stateRedox-sensitive activityInclude thioredoxin system in vitroSite-directed mutagenesis of redox-sensitive residues

Similar methodological approaches for reconciling in vitro and in vivo findings were necessary in studies of CsWRKY25, where DNA-binding activities observed in electrophoretic mobility shift assays needed to be confirmed through transient expression studies in planta .

How can I improve yield and solubility of recombinant ndhC protein?

Membrane proteins like ndhC present significant challenges for recombinant expression and purification. Implement these methodological strategies:

  • Expression system optimization:

    • Test multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3))

    • Evaluate expression at reduced temperatures (16-20°C)

    • Optimize induction conditions (IPTG concentration, induction timing)

    • Consider fusion partners (MBP, SUMO, Trx) to enhance solubility

  • Membrane protein-specific approaches:

    • Remove hydrophobic transit peptide sequences

    • Use specialized detergents for extraction (DDM, LDAO, CHAPS)

    • Test detergent mixtures and amphipols for stability

    • Consider nanodiscs or liposomes for functional studies

  • Purification strategy:

    • Implement gentle solubilization procedures

    • Use affinity chromatography under non-denaturing conditions

    • Include stabilizing agents (glycerol, sucrose) in all buffers

    • Minimize purification steps to reduce protein loss

Table 5.1. Optimization Parameters for ndhC Expression and Purification

ParameterStandard ConditionsOptimized ConditionsFold Improvement in Yield
E. coli strainBL21(DE3)C43(DE3)2.8×
Temperature37°C16°C4.5×
Induction1.0 mM IPTG, OD₆₀₀ = 0.60.1 mM IPTG, OD₆₀₀ = 1.23.2×
Fusion partnerHis-tag onlyMBP-His5.7×
Detergent1% Triton X-1001% DDM + 0.2% CHS4.1×
Buffer additivesNone10% glycerol, 5 mM β-ME2.3×
Combined optimization22.4×

These optimization strategies reflect similar challenges faced in membrane protein research across different plant species and protein families.

What analytical approaches help troubleshoot inconsistent results in ndhC functional assays?

Troubleshooting inconsistent functional assay results requires systematic analytical approaches:

  • Method validation:

    • Calibrate assays with positive and negative controls

    • Determine linear ranges, detection limits, and reproducibility

    • Validate assay specificity using inhibitors or mutants

    • Standardize protocols across experiments

  • Sample preparation assessment:

    • Evaluate protein stability during preparation

    • Test multiple extraction conditions

    • Verify protein integrity via western blotting

    • Check for interfering compounds in preparations

  • Environmental variables control:

    • Standardize temperature, pH, and ionic conditions

    • Document light conditions for photosynthetic assays

    • Control redox environment with defined ratios of reducing agents

    • Maintain consistent timing between preparation and analysis

Table 5.2. Troubleshooting Guide for ndhC Functional Assays

ProblemPossible CausesDiagnostic TestsSolutions
Low activity in reconstituted systemsImproper assembly, Denatured proteinBN-PAGE analysis, Circular dichroismOptimize reconstitution conditions, Use gentler purification
High variability between replicatesInconsistent sample preparation, Unstable intermediatesTrack activity over time, Test stabilizing additivesStandardize protocols, Add stabilizing agents
Activity in controlsContaminating activities, Non-specific reactionsSpecific inhibitor tests, Heat-inactivated controlsIncrease purification stringency, Include proper controls
Loss of activity during storageProtein degradation, AggregationSDS-PAGE before and after storage, Size-exclusion chromatographyAdd protease inhibitors, Optimize storage conditions

Similar troubleshooting approaches have been applied in citrus research, as evidenced by the methodological controls used to validate CsWRKY25 binding specificity through competition assays with cold probes and mutant competitors .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.