Recombinant Citrus sinensis NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Citrus sinensis NAD(P)H-Quinone Oxidoreductase Subunit 4L, Chloroplastic (ndhE)

Recombinant Citrus sinensis NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE) is a chloroplast-localized enzyme involved in photosynthetic and respiratory electron transport chains. It belongs to the NAD(P)H dehydrogenase (NDH) complex, which facilitates electron transfer from NAD(P)H to plastoquinone, contributing to proton gradient formation and energy conservation in chloroplasts . This recombinant protein is engineered for research applications, enabling studies on photosynthesis, stress responses, and metabolic engineering in plants .

Sequence and Molecular Properties

  • Amino Acid Sequence:
    The full-length protein (1–101 amino acids) includes the conserved motif MmLEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINFVTFSDFFDSRQLKGDIFSIFVIAIAAAEAAIGSAIVSSIYRNRKSTRINQSTLLNK .

  • Molecular Weight: ~11.3 kDa .

  • Domains: Features iron-sulfur (Fe-S) clusters and FMN-binding domains critical for electron transfer .

Recombinant Production

  • Expression System: Cell-free expression systems are used to produce the protein with ≥85% purity (SDS-PAGE verified) .

  • Storage: Stable in Tris-based buffer with 50% glycerol at -20°C or -80°C .

Functional Role in Chloroplasts

The ndhE subunit is integral to the NDH complex, which performs two key roles:

  1. Photosynthetic Cyclic Electron Flow: Maintains ATP/NADPH balance by recycling electrons to plastoquinone .

  2. Chlororespiration: Protects chloroplasts under stress by regulating redox homeostasis .

Key reactions:

\text{NAD(P)H} + \text{Plastoquinone} \rightarrow \text{NAD(P)^+} + \text{Plastoquinol} \quad \text{(coupled with proton translocation)}[7]

Metabolic Engineering

Recombinant ndhE is utilized in synthetic biology approaches for terpenoid biosynthesis. For example, co-expression with MVA/DXP pathway enzymes enhances precursor availability (e.g., IPP/DMAPP) for citrus terpenoid production .

Biochemical Studies

  • Kinetic Analysis: Studies focus on its electron transfer efficiency under varying pH and redox conditions .

  • Mutagenesis: Residues D-D-X-X-D/E (SEQ ID NO:1) are critical for quinone binding .

Comparative Data Table

PropertyValue/SourceReference
Molecular Weight11,337 Da
Purity≥85% (SDS-PAGE)
UniProt AccessionQ6ENA5
GenBank IDYP_052817.1
Key Conserved MotifsD-D-X-X-D/E, Fe-S clusters
Expression HostCell-free system

Genomic and Annotation Resources

  • Genomic Location: Mapped to Citrus sinensis chloroplast genome (NCBI Accession: NC_005973.1) .

  • Pathway Integration: Annotated in the Citrus Genome Database (CGD) under pathways for photosynthesis and stress response .

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade activity; single-use aliquots are recommended .

  • Functional Studies: Further research is needed to elucidate its role in abiotic stress tolerance and hybrid bioengineering systems .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis)
Target Names
ndhE
Target Protein Sequence
MMLEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINFVTFSDFFDSRQLKGD IFSIFVIAIAAAEAAIGSAIVSSIYRNRKSTRINQSTLLNK
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.

Database Links

KEGG: cit:4271141

Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of NAD(P)H-quinone oxidoreductase subunit 4L in Citrus sinensis?

NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) in Citrus sinensis is a chloroplast-encoded protein that functions as a component of the NADH dehydrogenase-like complex in the chloroplast electron transport chain. The protein is involved in cyclic electron flow around photosystem I and contributes to ATP synthesis without NADPH production. This process is particularly important under stress conditions when linear electron transport may be impaired. In Citrus species, this protein appears to contribute to defense mechanisms, particularly in response to pathogen attack through mediation of reactive oxygen species (ROS) generation, as evidenced by transcriptome analyses of Citrus sinensis during Diaporthe citri infection .

How is ndhE gene expression regulated in Citrus sinensis during pathogen infection?

The expression of ndhE and related oxidoreductase genes in Citrus sinensis is upregulated during pathogen infection, particularly in response to Diaporthe citri, the causative agent of citrus melanose disease. Research using RNA-Seq technology and qRT-PCR validation has demonstrated that:

  • Significant differential expression of ROS-related genes, including oxidoreductases, occurs within 72 hours after fungal inoculation

  • The expression pattern correlates with ROS accumulation as detected by DAB staining

  • Gene expression regulation appears to involve the MAPK signaling pathway and glutathione metabolism pathways

This regulation is part of a coordinated defense response where the oxidoreductase activity contributes to ROS production as an antimicrobial strategy. Researchers investigating this regulation should employ time-course experiments with sampling at multiple intervals (0h, 24h, 72h) after pathogen exposure to capture the dynamic regulation patterns .

What methodologies are most effective for expressing recombinant Citrus sinensis ndhE in heterologous systems?

For successful heterologous expression of recombinant Citrus sinensis ndhE, researchers should consider:

Bacterial Expression Systems:

  • Use E. coli BL21(DE3) with pET vectors containing optimized codons for chloroplastic proteins

  • Express as a fusion protein with solubility tags such as MBP or SUMO

  • Grow cultures at lower temperatures (16-18°C) after induction to improve proper folding

  • Include 1-2% glucose in the medium to reduce basal expression prior to induction

Plant-Based Expression:

  • Agrobacterium-mediated transient expression in Nicotiana benthamiana has been successfully used for expressing Citrus oxidoreductases, particularly when studying functional aspects

  • For stable transformation, consider chloroplast transformation approaches which provide high-level expression through homologous recombination into the plastid genome

  • When using Agrobacterium-mediated systems, researchers should ensure proper subcellular localization signals are included in the construct to direct the protein to chloroplasts

The choice of expression system should be guided by the experimental goals. For structural studies, bacterial systems may be preferable due to higher yields, while functional studies may benefit from plant-based expression systems that provide a more native environment for protein folding and post-translational modifications .

How does the function of ndhE in Citrus sinensis compare to its orthologs in other plant species?

The ndhE protein in Citrus sinensis shares functional similarities with orthologs in other plant species but also exhibits species-specific characteristics:

Conserved Functions:

  • Across plant species, ndhE functions as part of the NDH complex in chloroplasts

  • Contributes to cyclic electron flow around photosystem I

  • Enhances tolerance to various abiotic stresses by optimizing energy production

Species-Specific Variations:

  • In Citrus sinensis, ndhE appears to be more significantly involved in pathogen defense mechanisms through ROS generation than some other species

  • The genomic organization around ndhE differs between plant families - in Asteraceae species like Artemisia frigida, there are unique rearrangements in the SSC region where ndhE is located, while Citrus follows the more common angiosperm pattern

  • Expression patterns during stress responses vary by species, with Citrus showing particularly strong induction during fungal pathogen attack

Researchers investigating comparative aspects should employ multiple sequence alignments of ndhE from diverse plant species, followed by analysis of selection pressure on specific protein domains to identify regions under adaptive evolution. Functional complementation studies, where the Citrus ndhE is expressed in mutants of model plants lacking functional ndhE, can provide insights into functional conservation and divergence .

What roles does ndhE play in ROS-mediated defense mechanisms in Citrus sinensis?

The ndhE protein contributes to ROS-mediated defense mechanisms in Citrus sinensis through several interconnected pathways:

Direct Mechanisms:

  • Participates in electron transport processes that can generate ROS when activated during stress

  • Functions in coordination with other oxidoreductases to modulate cellular redox status

  • May contribute to localized ROS production at infection sites

Indirect Contributions:

  • Functions as part of a broader network of ROS-related proteins, including heat shock proteins (HSPs) and peroxidases, which show coordinated expression during pathogen attack

  • Transcriptomic data from Citrus sinensis infected with Diaporthe citri reveals that ndhE expression correlates with broader defense gene activation

  • Protein-protein interaction networks indicate functional relationships between ndhE and other stress-response proteins

Experimental data demonstrates that Citrus sinensis initiates defense against D. citri infection within 24 hours by generating ROS, with peak differential gene expression occurring at 72 hours post-infection. This pattern suggests ndhE participates in sustained rather than initial ROS production. Researchers should design experiments with appropriate temporal resolution to capture this dynamic relationship between gene expression and ROS production .

What are the most effective protocols for isolating and purifying recombinant ndhE protein for functional studies?

For successful isolation and purification of recombinant Citrus sinensis ndhE, researchers should follow this optimized protocol:

Expression Preparation:

  • Express the protein with an affinity tag (His6 or FLAG) for easier purification

  • Include stabilizing agents such as glycerol (50%) in the expression medium

  • Harvest cells during log phase growth for optimal protein yield

Extraction Protocol:

  • Resuspend cell pellet in Tris-based buffer (50 mM Tris-HCl, pH 7.5, 150 mM NaCl)

  • Add protease inhibitors (PMSF, leupeptin, pepstatin)

  • Use gentle lysis methods (sonication with short pulses) to avoid protein aggregation

  • Centrifuge at 10,000×g for 20 minutes to remove cell debris

  • Ultracentrifuge at 100,000×g for 1 hour to separate membrane fractions if studying native conformations

Purification Strategy:

  • For His-tagged proteins, use Ni-NTA affinity chromatography with imidazole gradients (20-250 mM)

  • Follow with size exclusion chromatography to remove aggregates and contaminants

  • Assess purity by SDS-PAGE (12-15% gels optimal for this 101-amino acid protein)

  • Store in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage

This protocol is specifically optimized for ndhE based on its hydrophobic properties and tendency to form inclusion bodies when overexpressed. The use of lower induction temperatures and specific buffer compositions helps maintain protein stability throughout the purification process .

How can researchers effectively analyze the role of ndhE in ROS production during pathogen defense?

To effectively analyze ndhE's role in ROS production during pathogen defense, researchers should implement a multi-technique approach:

In vivo Analysis:

  • DAB (3,3'-diaminobenzidine) Staining: Apply to infected and uninfected Citrus sinensis leaves at multiple time points (0h, 24h, 48h, 72h) to visualize hydrogen peroxide accumulation. This technique has successfully demonstrated ROS generation within 24h of D. citri infection .

  • NBT (Nitroblue Tetrazolium) Staining: Complement DAB staining to detect superoxide radicals specifically.

  • DCFDA Fluorescence Microscopy: Use 2',7'-dichlorofluorescein diacetate for more sensitive detection of general ROS levels with subcellular resolution.

Molecular Analysis:

  • RNA-Seq Analysis: Compare transcriptomes of infected versus uninfected leaves to identify co-regulated genes.

  • qRT-PCR Validation: Confirm expression patterns of ndhE and related genes using primers specific to conserved regions.

  • Protein-Protein Interaction Networks: Use yeast two-hybrid or co-immunoprecipitation to identify proteins that interact with ndhE during infection response.

Functional Validation:

  • Virus-Induced Gene Silencing (VIGS): Silence ndhE in Citrus and assess changes in ROS production and pathogen susceptibility.

  • Heterologous Expression: Express Citrus ndhE in model systems like Nicotiana benthamiana through Agrobacterium-mediated transient expression and measure resulting ROS production through luminol-based chemiluminescence assays .

A comprehensive experimental design should include appropriate controls and time-course sampling to capture the dynamic nature of the defense response. Analysis of multiple ROS species and correlation with gene expression data will provide the most complete picture of ndhE's role in this process .

What experimental designs are recommended for studying the interactions between ndhE and other components of the chloroplast electron transport chain?

To study interactions between ndhE and other components of the chloroplast electron transport chain, researchers should consider the following experimental designs:

In Vitro Interaction Studies:

  • Pull-down Assays: Use recombinant tagged ndhE as bait to identify interacting proteins from chloroplast extracts.

  • Surface Plasmon Resonance (SPR): Measure binding kinetics between purified ndhE and candidate interaction partners.

  • Isothermal Titration Calorimetry (ITC): Determine binding constants and thermodynamic parameters of protein-protein interactions.

In Vivo Analyses:

  • Split-GFP Complementation: Fuse ndhE and potential interacting proteins with complementary GFP fragments to visualize interactions in planta.

  • Co-immunoprecipitation (Co-IP): Use specific antibodies against ndhE to precipitate protein complexes from chloroplast preparations.

  • Blue Native-PAGE: Separate intact protein complexes from solubilized thylakoid membranes to identify ndhE-containing assemblies.

Functional Relationship Studies:

  • Electron Transport Measurements: Use oxygen electrode or chlorophyll fluorescence techniques to measure electron transport rates in plants with altered ndhE expression.

  • Chloroplast Isolation and Subfractionation: Separate thylakoid membrane complexes to determine the precise localization of ndhE.

  • Comparative Analysis: Design experiments that compare wild-type plants with ndhE-deficient mutants under various stress conditions to assess functional consequences of disrupted interactions.

When executing these experiments, researchers should consider the fragile nature of membrane protein complexes and use gentle solubilization techniques (e.g., digitonin or n-dodecyl-β-D-maltoside) that preserve native interactions. Additionally, performing experiments under different light conditions and stress treatments will provide insights into how these interactions change in response to environmental factors .

What bioinformatic tools are most suitable for analyzing structural and functional aspects of ndhE?

For comprehensive bioinformatic analysis of ndhE structural and functional aspects, researchers should utilize the following specialized tools and approaches:

Sequence Analysis Tools:

  • Multiple Sequence Alignment: Use MUSCLE or CLUSTAL Omega to align ndhE sequences across species, revealing conserved domains and species-specific variations.

  • Phylogenetic Analysis: Employ MEGA X or PhyML to construct phylogenetic trees that illustrate evolutionary relationships.

  • Selection Pressure Analysis: Use PAML or HyPhy to identify sites under positive selection, indicating functional adaptation.

Structural Prediction Tools:

  • Transmembrane Domain Prediction: TMHMM or HMMTOP for identifying membrane-spanning regions crucial for ndhE function.

  • Protein Structure Prediction: AlphaFold2 or RoseTTAFold to generate 3D structural models, particularly valuable for this chloroplastic membrane protein.

  • Molecular Docking: AutoDock or HADDOCK to predict interactions with other components of the electron transport chain.

Functional Prediction Approaches:

  • Gene Ontology (GO) Analysis: Use tools like Blast2GO to predict functional categories.

  • Protein-Protein Interaction Prediction: STRING or STITCH databases to identify potential interacting partners.

  • Co-expression Network Analysis: Analyze transcriptomic data using WGCNA (Weighted Gene Co-expression Network Analysis) to identify genes co-regulated with ndhE during stress responses.

Integration of Results:
When working with ndhE, it's essential to integrate results from multiple bioinformatic approaches. For example, combining structure prediction with conservation analysis can identify functionally critical residues. Similarly, mapping transcriptome data from pathogen response studies onto protein interaction networks can reveal how ndhE contributes to broader defense mechanisms in Citrus sinensis .

How can researchers differentiate between the roles of ndhE and other similar oxidoreductases in stress response experiments?

Differentiating between the roles of ndhE and other oxidoreductases in stress response experiments requires careful experimental design and analytical approaches:

Experimental Differentiation Strategies:

  • Gene-Specific Manipulation:

    • Create RNAi or CRISPR-based knockdowns specifically targeting ndhE

    • Develop overexpression lines for ndhE with subcellular targeting to chloroplasts

    • Compare phenotypes against plants with manipulated expression of other oxidoreductases

  • Protein Localization Studies:

    • Use fluorescent protein fusions to confirm chloroplastic localization of ndhE

    • Perform immunogold electron microscopy to determine precise suborganellar localization

    • Compare localization patterns before and after stress treatments

  • Biochemical Differentiation:

    • Conduct enzyme assays using specific substrates and inhibitors

    • Measure kinetic parameters (Km, Vmax) to identify substrate preferences

    • Compare activity under different pH and redox conditions that might favor specific oxidoreductases

Analytical Approaches:

  • Temporal Resolution:

    • Track expression and activity changes at multiple timepoints after stress application

    • Create temporal expression profiles for ndhE and other oxidoreductases

    • Identify sequential activation patterns that suggest specific roles

  • Comparative Analysis:

    • Create a table of oxidoreductase responses across multiple stress conditions

    • Example format:

    OxidoreductasePathogen StressDrought StressHigh Light StressSalt Stress
    ndhEHigh induction (24h)Moderate induction (48h)High induction (2h)Low induction
    RBOHHigh induction (12h)Low inductionModerate inductionHigh induction
    APXModerate inductionHigh inductionHigh inductionHigh induction
  • Integration with Metabolomic Data:

    • Correlate changes in specific metabolites with the activity of different oxidoreductases

    • Use pathway analysis to identify which metabolic pathways are most affected by ndhE activity

This multi-faceted approach allows researchers to build a comprehensive picture of ndhE's specific contributions to stress responses, distinguishing its role from other oxidoreductases that may have overlapping functions .

What are the potential applications of engineering ndhE for enhanced stress resistance in Citrus species?

Engineering ndhE for enhanced stress resistance in Citrus species presents several promising research avenues with significant agricultural implications:

Genetic Engineering Approaches:

  • Overexpression Strategies:

    • Constitutive overexpression of ndhE using strong promoters

    • Stress-inducible expression using pathogen-responsive promoters

    • Chloroplast transformation for high-level expression within the organelle

  • Structural Modifications:

    • Introduction of specific amino acid substitutions based on comparative analysis of stress-tolerant Citrus varieties

    • Engineering protein variants with enhanced stability or altered regulatory properties

    • Creation of chimeric proteins combining functional domains from different species

  • Regulatory Engineering:

    • Modification of transcriptional and post-transcriptional regulation

    • Engineering of redox-sensitive regulatory elements to fine-tune activation

    • Co-expression with interacting partners to enhance complex formation

Anticipated Benefits:

  • Enhanced Pathogen Resistance:

    • Improved ROS production during pathogen attack, particularly against Diaporthe citri

    • Faster activation of defense responses

    • More effective containment of infection sites

  • Abiotic Stress Tolerance:

    • Better chloroplast function under high light or temperature stress

    • Improved energy balance during drought stress

    • Enhanced recovery mechanisms after stress exposure

  • Physiological Improvements:

    • Optimized photosynthetic efficiency under fluctuating environmental conditions

    • Better maintenance of redox homeostasis

    • Improved reproductive success under stress conditions

When pursuing these engineering strategies, researchers should implement careful phenotypic evaluation under both normal and stress conditions, ensuring that enhanced stress resistance doesn't come at the cost of reduced growth or yield under non-stress conditions. Additionally, field trials in diverse environments will be necessary to validate laboratory findings in agricultural settings .

How might the study of ndhE contribute to our understanding of chloroplast evolution and endosymbiotic gene transfer?

The study of ndhE in Citrus sinensis provides valuable insights into chloroplast evolution and endosymbiotic gene transfer (EGT) through several research perspectives:

Evolutionary Conservation Analysis:

  • The ndhE gene remains chloroplast-encoded across most plant lineages, despite extensive EGT of other genes to the nucleus

  • Comparative genomic studies reveal that the genomic context of ndhE varies among plant families, with unique rearrangements in some groups like Asteraceae

  • Analysis of selection pressure on ndhE sequences can identify functionally critical regions maintained throughout evolution

Functional Constraints and EGT:

  • The retention of ndhE in the chloroplast genome suggests functional constraints against nuclear transfer

  • These constraints may include:

    • Requirement for coordinated expression with other chloroplast genes

    • Hydrophobic properties of the protein that complicate import mechanisms

    • Redox-dependent regulation that requires chloroplastic location

Experimental Approaches for Evolutionary Studies:

  • Reconstruct the evolutionary history of the NDH complex through phylogenetic analysis of all subunits, comparing those that have undergone EGT with those retained in the chloroplast

  • Create synthetic biology experiments where ndhE is nuclear-encoded and targeted back to chloroplasts to test functional equivalence

  • Compare chloroplast genome organization across diverse plant species, focusing on the small single-copy (SSC) region where ndhE is typically located

Implications for Understanding Organellar Evolution:

  • The study of ndhE and similar genes provides a window into the ongoing evolutionary process of organellar gene transfer

  • Insights from these studies contribute to understanding why some genes resist nuclear transfer, informing broader theories of endosymbiotic evolution

  • The varying importance of ndhE in stress responses across species may reflect adaptive evolution of chloroplast function in different ecological niches

This research area connects fundamental evolutionary biology with practical applications in crop improvement, as understanding the evolutionary constraints on chloroplast genes informs strategies for engineering improved stress resistance in agricultural species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.