Recombinant Citrus sinensis Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. An additional fee will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of the protein is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis)
Target Names
psbA
Target Protein Sequence
MTAILERRESERLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient. This gradient is subsequently used for ATP formation. PSII comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links

KEGG: cit:4271240

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein (psbA) and what is its function in Citrus sinensis?

The Photosystem Q(B) protein, also known as psbA or PSII D1 protein, is a critical component of Photosystem II in the photosynthetic machinery of Citrus sinensis (sweet orange). This protein plays a fundamental role in the electron transport chain during photosynthesis, specifically in the water-splitting process and electron transfer . The protein is encoded by the psbA gene in the chloroplast genome and functions as part of the reaction center of Photosystem II, facilitating the binding of plastoquinone B (Q(B)) and participating in the electron transport from water to plastoquinone . The protein contains 344 amino acids in its full-length form and is crucial for the plant's ability to convert light energy into chemical energy during photosynthesis .

How is recombinant psbA protein from Citrus sinensis typically expressed and purified?

Recombinant Citrus sinensis Photosystem Q(B) protein (psbA) is typically expressed in Escherichia coli expression systems with a polyhistidine (His) tag to facilitate purification . The expression process involves:

  • Cloning the full-length psbA gene (encoding amino acids 1-344) into a suitable expression vector

  • Transformation into E. coli expression hosts optimized for membrane protein production

  • Induction of protein expression under controlled temperature and duration conditions

  • Cell harvesting and lysis to extract the recombinant protein

  • Purification via immobilized metal affinity chromatography (IMAC) using the His-tag

  • Further purification steps may include size exclusion chromatography or ion exchange chromatography

The purified protein is typically formulated in a Tris-based buffer with glycerol to maintain stability. For long-term storage, the protein can be lyophilized or stored as aliquots at -20°C/-80°C to prevent repeated freeze-thaw cycles . Researchers should reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, preferably with 5-50% glycerol as a cryoprotectant for extended storage .

How is the psbA gene used in plant DNA barcoding studies?

The psbA gene, particularly the psbA-trnH intergenic spacer region, is widely used as a DNA barcode marker for plant identification and authentication studies due to its high variability among plant species . The methodology for using psbA in DNA barcoding involves:

  • Genomic DNA extraction from plant tissue samples

  • PCR amplification using trnH-psbA primer pairs

  • DNA sequencing of the amplified region

  • Sequence alignment analysis and comparison with reference databases

  • Construction of phylogenetic dendrograms to establish relationships

The psbA-trnH region has been successfully applied in various authentication studies, including the identification of medicinal plants and herbal tea components . In a study examining herbal tea authentication, researchers were able to accurately identify plants used in mock mixtures through DNA metabarcoding of the psbA-trnH region, although certain limitations were observed for species like Althaea officinalis and Solidago virgaurea, which were not detected using this marker alone . This highlights the importance of using multiple barcode regions (such as combining psbA-trnH with ITS2) for comprehensive plant identification.

What are the optimal buffer conditions for maintaining psbA protein stability during experimental procedures?

The stability of the recombinant Citrus sinensis psbA protein is significantly influenced by buffer composition and storage conditions. Based on experimental data, the following buffer system has been established as optimal:

Buffer ComponentConcentration/ConditionPurpose
Tris-based bufferpH 8.0Maintains protein structural integrity
Trehalose6%Acts as a stabilizing agent
Glycerol50% (final concentration)Prevents freeze-thaw damage
Temperature-20°C to -80°CLong-term storage
Working temperature4°CFor experiments lasting up to one week

For reconstitution of lyophilized protein, deionized sterile water is recommended to achieve a concentration of 0.1-1.0 mg/mL . The addition of glycerol is crucial for maintaining protein stability during freeze-thaw cycles, with experimental evidence suggesting that 50% glycerol provides optimal protection against denaturation . Researchers should note that repeated freeze-thaw cycles significantly reduce protein activity, so working aliquots should be prepared and stored at 4°C for short-term use (up to one week) .

How can researchers evaluate the functional activity of recombinant psbA protein in vitro?

Assessing the functional activity of recombinant Citrus sinensis psbA protein requires specialized techniques that measure electron transport capabilities and structural integrity. A comprehensive evaluation protocol includes:

  • Electron Transport Activity Assay:

    • Measurement of electron transfer from artificial electron donors to acceptors using spectrophotometric methods

    • Quantification of oxygen evolution using an oxygen electrode system

    • Assessment of fluorescence induction kinetics to evaluate energy transfer efficiency

  • Binding Assays:

    • Evaluation of plastoquinone binding affinity using isothermal titration calorimetry

    • Competitive binding assays with known inhibitors (e.g., DCMU, atrazine)

  • Structural Integrity Assessment:

    • Circular dichroism spectroscopy to analyze secondary structure elements

    • Thermal stability assays to determine melting temperature and conformational stability

    • Limited proteolysis to assess proper folding

  • Incorporation into Liposomes or Nanodiscs:

    • Reconstitution into membrane mimetics to evaluate membrane insertion and orientation

    • Measurement of activity in a more native-like environment

Researchers should establish positive controls using native psbA protein or well-characterized recombinant versions to validate the functionality of their preparation. Activity measurements should be performed under controlled light conditions, as the protein is sensitive to photodamage, which can affect experimental reproducibility.

What are the implications of psbA sequence variations in developing HLB-tolerant citrus varieties?

The psbA gene sequence variations may have significant implications for developing Huanglongbing (HLB)-tolerant citrus varieties through genetic breeding approaches. HLB, also known as citrus greening disease, represents a major threat to citrus production worldwide . Analysis of psbA sequence polymorphisms reveals:

How does the psbA-trnH barcode region compare with other molecular markers for authenticating Citrus species?

The psbA-trnH intergenic spacer region has specific advantages and limitations when compared to other molecular markers for Citrus species authentication:

Molecular MarkerAdvantagesLimitationsResolution Level
psbA-trnH- High variability
- Relatively short length
- Easy amplification
- Universal primers available
- Some species not detectable
- Alignment challenges due to indels
Genus to species
ITS2- Highly conserved flanking regions
- Moderate variability
- Extensive reference databases
- Multiple copies in genome
- Potential for chimeric sequences
Species to variety
matK- Coding region
- Moderate evolution rate
- Few alignment problems
- Amplification difficulties
- Limited variability in closely related species
Family to genus
rbcL- Universality
- Easy alignment
- Stable amplification
- Low discriminatory power
- Slow evolution rate
Family to genus

Experimental evidence from DNA metabarcoding studies of plant mixtures indicates that psbA-trnH may fail to detect certain species (e.g., Althaea officinalis and Solidago virgaurea) even when they are present in the sample . This suggests that a multi-locus approach combining psbA-trnH with complementary markers like ITS2 provides more robust authentication results. Principal Coordinate Analysis (PCoA) with Bray-Curtis distance measurements has shown that using genomic DNA mixtures rather than biomass mixtures better approximates the expected sample composition when performing authentication studies using the psbA-trnH marker .

For Citrus species specifically, the psbA-trnH region has demonstrated sufficient variability to distinguish between sweet orange (Citrus sinensis) and sour orange (Citrus aurantium), as well as various sweet orange cultivars . This makes it particularly valuable for authenticating citrus products and verifying the identity of breeding materials in improvement programs.

What methodological approaches can overcome the limitations of psbA-trnH barcoding for species that are difficult to detect?

Several methodological refinements can address the limitations observed when using psbA-trnH barcoding for species that are challenging to detect:

  • Multi-locus Barcoding Approach:

    • Combine psbA-trnH with complementary markers such as ITS2, matK, and rbcL

    • Develop a weighted scoring system that accounts for marker-specific detection biases

    • Research indicates that ITS2 can successfully detect species missed by psbA-trnH analysis

  • Optimized DNA Extraction Protocols:

    • Implement specialized extraction methods for recalcitrant plant tissues

    • Use mechanical disruption techniques optimized for different plant tissues

    • Add RNA carrier molecules to improve DNA recovery from low-yield samples

  • Advanced Amplification Strategies:

    • Design modified primers with enhanced specificity for difficult-to-amplify regions

    • Employ touchdown PCR or nested PCR approaches to increase amplification success

    • Add PCR enhancers (DMSO, betaine) to overcome secondary structure challenges

  • High-Throughput Sequencing Optimization:

    • Increase sequencing depth to detect low-abundance species

    • Apply bioinformatic filtering algorithms that account for known taxonomic biases

    • Utilize spike-in controls to calibrate detection thresholds

  • Sample Preparation Refinements:

    • Implement genomic DNA mixture approaches rather than biomass mixtures

    • PCoA analysis with Bray-Curtis distance measurements has shown that genomic DNA mixtures better approximate expected sample composition compared to biomass mixtures

    • Consider differential grinding techniques based on tissue hardness

Researchers have documented that for authentication studies, preparing mock mixtures from pre-extracted genomic DNA rather than biomass significantly improves detection accuracy for challenging species . This approach minimizes biases introduced during the DNA extraction phase and provides a more balanced representation of all species present in the sample.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.