Recombinant Clavibacter michiganensis subsp. michiganensis UPF0060 membrane protein CMM_0279 (CMM_0279)

What is the primary structure and key characteristics of CMM_0279 protein?

CMM_0279 is a UPF0060 family membrane protein from Clavibacter michiganensis subsp. michiganensis with 112 amino acids. Its complete amino acid sequence is: MLLRTVILFALAAVAEIGGAWLVWQAVREGRPWWWAGLGVMALGAYGFIASLQADASFGRILAAYGGVFVAGSLVWGAVVDGYRPDRWDVIGAVVCLLGVAVIMFGPRGQGA . The protein contains hydrophobic regions characteristic of membrane proteins, with a predicted transmembrane domain structure. Analysis of the primary sequence suggests it belongs to the UPF0060 protein family, a group of uncharacterized membrane proteins conserved across bacterial species. For research applications, developing hydrophobicity plots using Kyte-Doolittle scale analysis can help identify transmembrane regions for targeted functional studies.

How should researchers properly store and reconstitute recombinant CMM_0279 protein?

Proper storage and reconstitution are critical for maintaining protein functionality. Store lyophilized CMM_0279 protein at -20°C/-80°C upon receipt, with aliquoting recommended for multiple use scenarios to prevent protein degradation from repeated freeze-thaw cycles . For reconstitution:

• Briefly centrifuge the vial prior to opening to bring contents to the bottom

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add 5-50% glycerol (final concentration) before aliquoting for long-term storage at -20°C/-80°C (50% glycerol is standard recommendation)

• For working stocks, store aliquots at 4°C for up to one week

This methodology preserves protein integrity while minimizing structural changes that could affect experimental outcomes.

What expression systems are most effective for CMM_0279 recombinant production?

The available recombinant CMM_0279 protein is successfully expressed in E. coli systems with an N-terminal His-tag . For researchers developing their own expression protocols, consider the following methodological approach:

For membrane proteins like CMM_0279, detergent screening is essential during purification to maintain native conformation. Start with a panel including DDM, LDAO, and OG detergents at concentrations just above their critical micelle concentration.

What experimental design approaches are most appropriate for functional characterization of CMM_0279?

When designing functional characterization experiments for CMM_0279, researchers should implement quasi-experimental approaches with appropriate controls to establish causality between interventions and outcomes. The untreated control group design with dependent pretest and posttest samples (Design C1 in quasi-experimental hierarchy) provides stronger evidence than simple pre-post testing without controls .

For membrane protein functional studies specifically:

• Design reconstitution experiments in proteoliposomes with:

  • Treatment group: Proteoliposomes with incorporated CMM_0279

  • Control group: Empty proteoliposomes

  • Measured variables: Membrane potential, ion flux, or substrate transport

• Implement time-series measurements (Design D1) to capture dynamic functional properties:

  • Multiple measurement points pre-intervention (O₁, O₂, O₃)

  • Intervention implementation (X)

  • Multiple measurement points post-intervention (O₄, O₅, O₆)

This approach minimizes threats to internal validity including history effects, maturation, and regression to the mean identified in Table 1 of the literature .

How can researchers effectively analyze potential structure-function relationships in CMM_0279?

Structure-function analysis of CMM_0279 requires integrated computational and experimental approaches. Based on the 112-amino acid sequence, implement this methodological workflow:

• Computational stage:

  • Perform hydrophobicity analysis to identify transmembrane domains

  • Generate homology models using related UPF0060 family proteins

  • Conduct molecular dynamics simulations in a lipid bilayer environment

• Experimental validation:

  • Site-directed mutagenesis targeting conserved residues (particularly those in the sequence: GRPWWWAGLGVMALGAYG)

  • Circular dichroism spectroscopy to verify secondary structure elements

  • Crosslinking studies to identify interaction partners

• Functional correlation:

  • Membrane localization assays with fluorescent protein fusions

  • Electrophysiological measurements if ion transport is suspected

  • Bacterial phenotype rescue experiments in knockout models

This integrated approach allows researchers to connect structural features to functional properties, providing insights into the protein's biological role.

What are the methodological considerations for investigating CMM_0279 interactions with other proteins?

Investigating protein-protein interactions requires careful experimental design using the following methodological framework:

• In vitro approaches:

  • Pull-down assays using His-tagged CMM_0279 as bait protein

  • Surface plasmon resonance (SPR) for kinetic interaction measurements

  • Biolayer interferometry for real-time interaction analysis

• In vivo approaches:

  • Bacterial two-hybrid systems optimized for membrane proteins

  • Proximity-dependent biotin identification (BioID) for transient interactions

  • FRET-based interaction assays if fluorescent protein fusions are functional

• Design considerations:

  • Implement C3 quasi-experimental design (switching replications) where possible

  • Include nonequivalent dependent variables as controls

  • Account for detergent interference in sample preparation

When interpreting interaction data, researchers should apply multiple testing corrections and validate findings through at least two orthogonal methods to minimize false positives common in membrane protein interaction studies.

How can researchers address common challenges in CMM_0279 purification and stability?

Membrane protein purification presents unique challenges. For CMM_0279, implement this troubleshooting workflow:

For storage stability, the recombinant protein should be maintained in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . This formulation has been empirically determined to maximize stability while maintaining conformational integrity.

What statistical approaches are most appropriate for analyzing CMM_0279 experimental data?

When analyzing experimental data related to CMM_0279 functional studies, researchers should consider:

• For time-series experiments:

  • Interrupted time series analysis is preferred for multiple measurement points before and after intervention

  • Consider segmented regression analysis to detect changes in trend

  • Account for autocorrelation in repeated measurements

• For comparative studies:

  • Mixed effects modeling to handle nested data structures

  • Analysis of covariance (ANCOVA) when baseline measurements differ between groups

  • Non-parametric alternatives when normality assumptions are violated

• For quasi-experimental designs:

  • Difference-in-differences approach for untreated control group designs

  • Propensity score matching to address selection bias in non-randomized studies

  • Sensitivity analyses to assess robustness of findings

These statistical approaches align with the quasi-experimental design hierarchy discussed in the literature, where higher-level designs (C and D categories) typically provide stronger causal evidence than lower-level designs (A and B categories) .

How can researchers design experiments to investigate the role of CMM_0279 in bacterial pathogenicity?

Investigating CMM_0279's role in Clavibacter michiganensis pathogenicity requires careful experimental design:

• Gene knockout/knockdown studies:

  • Generate CMM_0279 deletion mutants using homologous recombination

  • Implement CRISPR-Cas9 systems for precise genetic manipulation

  • Compare wild-type, knockout, and complemented strains in plant infection models

• Experimental design considerations:

  • Implement design C3 (switching replications) with three groups:

    • Wild-type bacteria

    • CMM_0279 knockout

    • Complemented strain (knockout with restored CMM_0279)

  • Measure multiple dependent variables:

    • Plant symptom development

    • Bacterial colonization efficiency

    • Host defense response markers

• Advanced approaches:

  • Single-cell analysis of bacteria-host interactions

  • Transcriptome analysis of host response to wild-type vs. mutant bacteria

  • In planta imaging of fluorescently labeled bacteria to track colonization patterns

This comprehensive approach allows researchers to establish causal relationships between CMM_0279 function and bacterial virulence while controlling for confounding factors.

What are the best approaches for structural characterization of CMM_0279?

Structural characterization of membrane proteins like CMM_0279 requires specialized techniques:

When designing structural studies, researchers should plan for adequate protein production (typically >5mg of pure protein) and allocate resources for multiple technique application to generate complementary structural information.

How can researchers design experiments to address data contradictions in CMM_0279 functional studies?

Addressing contradictory data in CMM_0279 research requires systematic methodological approaches:

• Identify sources of variation:

  • Experimental conditions (detergents, pH, temperature)

  • Protein preparation methods

  • Measurement techniques and instruments

• Design resolution experiments:

  • Implement C2 quasi-experimental design (double pretest) to establish baseline stability

  • Use factorial experimental designs to test multiple variables simultaneously

  • Include positive and negative controls with known outcomes

• Statistical approaches:

  • Meta-analysis of multiple experimental replicates

  • Bayesian analysis to incorporate prior knowledge

  • Sensitivity analysis to identify influential data points

• Reporting standards:

  • Document detailed methods according to reproducibility guidelines

  • Report effect sizes with confidence intervals, not just p-values

  • Share raw data and analysis code with collaborators

This systematic approach allows researchers to identify whether contradictions arise from methodological differences, true biological variability, or statistical artifacts.

What emerging technologies show promise for advancing CMM_0279 research?

Several cutting-edge technologies offer significant potential for advancing CMM_0279 research:

• AlphaFold and structural prediction:

  • Apply AI-based structural prediction specifically optimized for membrane proteins

  • Validate predictions with limited experimental data

  • Guide hypothesis generation for functional sites

• Single-molecule techniques:

  • Implement patch-clamp fluorometry for simultaneous functional and conformational measurements

  • Apply single-molecule FRET to monitor conformational changes

  • Develop high-speed atomic force microscopy protocols for membrane proteins

• Advanced genetic approaches:

  • Design CRISPR interference systems for titratable gene expression

  • Apply multiplexed genome engineering to test multiple variants simultaneously

  • Implement synthetic biology approaches to reconstitute minimal systems

• Systems biology integration:

  • Multi-omics approaches to place CMM_0279 in broader cellular context

  • Network analysis to identify functional interactions

  • Machine learning for pattern recognition in large datasets

These emerging technologies can help overcome current limitations in membrane protein research and provide new insights into CMM_0279 function in bacterial physiology and pathogenicity.