Recombinant Clavibacter michiganensis subsp. sepedonicus UPF0060 membrane protein CMS0846 (CMS0846)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CMS0846; UPF0060 membrane protein CMS0846
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) (Corynebacterium sepedonicum)
Target Names
CMS0846
Target Protein Sequence
MLLRTVILFALAAVAEIGGAWLIWQAVREGRPFWWAGLGVMALGAYGFIATLQADASFGR ILAAYGGVFVAGSLLWGTVVDGYRPDRWDVIGAVVCLVGVAVIMAAPRGQGA
Uniprot No.

Target Background

Database Links

KEGG: cms:CMS0846

Protein Families
UPF0060 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the CMS0846 membrane protein in Clavibacter michiganensis subsp. sepedonicus?

The CMS0846 membrane protein is encoded within the chromosome of Clavibacter michiganensis subsp. sepedonicus. While specific information about CMS0846 is limited in the current literature, studies of other Clavibacter michiganensis strains indicate that membrane proteins often reside within important pathogenicity islands (PAIs). For example, the chp/tomA pathogenicity island has been associated with virulence in tomato-infecting C. michiganensis strains . When investigating CMS0846, researchers should examine its genomic neighborhood to determine if it resides within a PAI or other functional gene cluster. Comparative genomic analyses can identify conserved regions across subspecies and potentially reveal functional associations.

How can I express recombinant CMS0846 protein for experimental studies?

Expression of recombinant CMS0846 requires specialized approaches due to its membrane protein nature. Based on established protocols for Clavibacter proteins, a recommended approach includes:

  • Codon optimization for expression host (E. coli, yeast, or insect cells)

  • Addition of purification tags (His6, FLAG, or Strep-tag II) at N- or C-terminus depending on membrane topology prediction

  • Use of specialized expression vectors that accommodate membrane proteins

  • Induction under mild conditions (lower temperature, reduced inducer concentration)

For Clavibacter proteins specifically, the pSelAct-Express system has been developed for controlled expression. This system enables recombination into permissive genomic locations identified using the permissR package . When expressing CMS0846, consider testing multiple constructs with varying tag positions to identify optimal expression conditions.

What approaches can be used to study membrane localization of CMS0846?

Confirming the membrane localization of CMS0846 requires multiple complementary approaches:

TechniqueApplicationLimitations
Subcellular fractionationIsolation of membrane fractions followed by Western blotCannot distinguish specific membrane locations
Fluorescent protein fusionIn vivo localization using fluorescent microscopyTag may interfere with localization
Immunogold electron microscopyPrecise localization at ultrastructural levelRequires specific antibodies
Protease protection assaysDetermination of topologyLimited by accessibility of protease sites

For bacterial membrane proteins like CMS0846, subcellular fractionation protocols typically involve cell disruption by sonication or French press, followed by differential centrifugation to separate membrane fractions from cytosolic components. Confirmation of membrane association can be further assessed by detergent solubilization tests using different detergents (DDM, LDAO, or SDS).

How does the transmembrane topology of CMS0846 influence its function in Clavibacter michiganensis subsp. sepedonicus?

The transmembrane topology of CMS0846 is critical for understanding its function. UPF0060 family membrane proteins typically contain multiple transmembrane domains (TMDs) that affect their orientation and functional properties. The insertion of these TMDs depends on several factors:

  • Hydrophobicity of the TMDs (which determines insertion mechanisms)

  • Charge distribution following the "positive-inside rule"

  • Presence of membrane-targeting sequences

For experimental determination of CMS0846 topology, combine computational predictions with empirical approaches such as cysteine accessibility labeling, glycosylation mapping (in eukaryotic expression systems), or SCAM (substituted cysteine accessibility method). The insertion mechanism likely involves the Sec61 complex or related bacterial SecYEG machinery, where TMDs are recognized and inserted via lateral gate opening . Understanding this topology will provide insights into which domains face the cytoplasm versus the periplasm, informing functional hypotheses about protein-protein interactions or enzymatic activities.

What role might CMS0846 play in Clavibacter michiganensis host specificity and virulence?

Although specific functions of CMS0846 have not been directly characterized, research on other Clavibacter membrane proteins suggests potential roles in host specificity and virulence. Studies of C. michiganensis have revealed that specific effector proteins, particularly those with allelic variations like chpG, can determine host range plasticity .

To investigate CMS0846's potential role in pathogenicity:

  • Generate markerless deletion mutants using the pSelAct-KO system optimized for Clavibacter

  • Perform complementation studies with different allelic variants

  • Conduct host infection assays on multiple plant species

  • Compare virulence phenotypes between wildtype and mutant strains

A particularly informative approach would be to create chimeric proteins by swapping domains between CMS0846 homologs from different Clavibacter subspecies with varying host ranges. If CMS0846 contributes to host specificity, domain swapping might alter pathogen virulence on different host plants, similar to observations with the chpG effector where allelic variants determined the ability to infect eggplant versus tomato .

What bioinformatic approaches can predict functional domains within CMS0846?

For comprehensive domain prediction and functional analysis of CMS0846, implement a multi-layered bioinformatic approach:

Analysis TypeToolsExpected Insights
Sequence homologyBLAST, HHpred, PfamIdentification of known domains and functional motifs
Structural predictionAlphaFold2, SWISS-MODELTertiary structure prediction and structural homology
Transmembrane topologyTMHMM, Phobius, TOPCONSMembrane-spanning regions and orientation
Evolutionary analysisPAML, ConSurfConservation patterns and selective pressure
Protein-protein interactionSTRING, PSICQUICPotential interaction partners

When analyzing results, pay particular attention to highly conserved residues within the UPF0060 family, as these often represent functionally crucial sites. Additionally, look for specialized motifs common in membrane proteins that mediate protein-protein interactions or substrate binding. The integration of these predictions with experimental validation through site-directed mutagenesis offers a powerful approach for functional characterization.

What genetic manipulation techniques are most effective for studying CMS0846 in Clavibacter michiganensis?

Recent advances in genetic tools for Clavibacter species have dramatically improved our ability to manipulate these bacteria. For studying CMS0846 specifically, consider these approaches:

  • Markerless deletion system: The pSelAct-KO system developed for Clavibacter allows for the creation of clean deletions without leaving antibiotic resistance markers. This system uses homology-based recombination followed by counterselection with 5-FC to create precise knockouts .

  • Chromosomal integration: The pSelAct-Express system enables integration of expression constructs into permissive regions of the Clavibacter genome. These regions can be identified using the permissR R package, which analyzes genomic data to predict locations that can tolerate insertion without disrupting essential functions .

  • Allelic replacement: For studying specific domains or residues, design constructs that replace the native CMS0846 gene with modified versions containing point mutations or domain swaps.

The implementation protocol requires:

  • Identification of appropriate flanking regions (typically 500-1000 bp)

  • Cloning these regions into the pSelAct-KO vector

  • Transformation into Clavibacter (often requiring electroporation with specific parameters: 2.5 kV, 200 Ω, 25 μF)

  • Selection on apramycin-containing media

  • Confirmation of merodiploid state by PCR

  • Counterselection on minimal M9 medium with 5-FC to identify recombinants

How can protein-protein interactions of CMS0846 be investigated in the bacterial membrane context?

Studying protein-protein interactions for membrane proteins like CMS0846 presents unique challenges that require specialized approaches:

TechniqueAdvantagesLimitationsApplication for CMS0846
Bacterial two-hybrid (BACTH)Allows screening in bacterial systemLimited to binary interactionsIdentify direct interaction partners
Co-immunoprecipitationDetects native complexesRequires membrane solubilizationVerify interactions in native context
Cross-linking mass spectrometryCaptures transient interactionsComplex data analysisMap interaction interfaces
FRET/BRETReal-time in vivo detectionRequires fluorescent taggingMonitor dynamic interactions
Split-GFP complementationVisual confirmation in cellsMay stabilize weak interactionsVerify and localize interactions

For membrane proteins specifically, chemical cross-linking followed by mass spectrometry offers particular advantages, as it can capture interactions within the native membrane environment before solubilization. When applying these methods to CMS0846, consider using membrane-permeable cross-linkers with varying spacer arm lengths to capture both direct and proximal interactions.

What purification strategies are most effective for obtaining functional recombinant CMS0846?

Purification of membrane proteins like CMS0846 requires specialized approaches:

  • Membrane extraction: Following expression, bacterial membranes are isolated through differential centrifugation (typically 100,000 × g for 1 hour).

  • Detergent screening: Test multiple detergents for optimal solubilization while maintaining function:

DetergentPropertiesRecommendation for CMS0846
DDMMild, widely usedGood starting point
LMNGEnhanced stabilityFor structural studies
DigitoninVery mildFor functional assays
SDSHarsh, denaturingAvoid for functional studies
  • Chromatography sequence:

    • IMAC (immobilized metal affinity chromatography) for His-tagged constructs

    • Size exclusion chromatography to remove aggregates

    • Optional ion exchange depending on protein properties

  • Quality assessment:

    • SDS-PAGE and Western blotting to confirm purity

    • Circular dichroism to verify secondary structure

    • Dynamic light scattering to assess monodispersity

For maintaining stability during purification, consider adding lipids (E. coli total lipid extract at 0.1-0.5 mg/ml) to all buffers post-solubilization. Additionally, glycerol (10-15%) and specific ligands (if known) can enhance stability throughout the purification process.

How can the membrane insertion mechanism of CMS0846 be experimentally determined?

The membrane insertion of CMS0846 likely occurs through established pathways for bacterial membrane proteins. To experimentally determine its insertion mechanism:

  • In vitro translation assays: Perform cell-free translation in the presence of bacterial membrane vesicles or reconstituted translocons. This allows observation of insertion efficiency under controlled conditions.

  • Crosslinking studies: Use site-specific photocrosslinking to identify translocon components that interact with CMS0846 during insertion.

  • Depletion studies: Create conditional depletion strains for various insertion machinery components (SecYEG, YidC) and assess CMS0846 membrane integration.

Based on knowledge of bacterial membrane protein biogenesis, CMS0846 likely follows one of two major pathways:

a) Co-translational insertion via the SecYEG translocon, where TMDs exit laterally into the membrane through the Sec61/SecY lateral gate
b) YidC-mediated insertion, particularly if CMS0846 has TMDs of lower hydrophobicity

These experiments would determine whether CMS0846 insertion depends primarily on the Sec machinery, YidC, or potentially both pathways working in concert.

What approaches can determine if CMS0846 forms homo-oligomeric complexes in the membrane?

Membrane proteins frequently form functional oligomers. To investigate the oligomeric state of CMS0846:

ApproachMethodologyExpected Outcomes
Analytical ultracentrifugationSedimentation velocity analysis of detergent-solubilized proteinDetermination of molecular weight and oligomeric state
Size exclusion chromatography with multi-angle light scattering (SEC-MALS)Analysis of purified proteinAbsolute molecular weight determination
Native PAGEElectrophoresis under non-denaturing conditionsVisualization of potential oligomeric species
Chemical crosslinkingUse of homobifunctional crosslinkers followed by SDS-PAGEDetection of specific oligomeric states
FRETEnergy transfer between differently labeled protein populationsEvidence of close association in membrane

For membrane proteins like CMS0846, crosslinking studies are particularly informative. Using membrane-permeable crosslinkers with different spacer arm lengths (e.g., DSS, BS3, or formaldehyde) can provide evidence of proximity in the native membrane environment. Subsequent mass spectrometry analysis of crosslinked products can identify specific interaction interfaces within the oligomeric complex.

What structural biology techniques are most promising for determining the 3D structure of CMS0846?

Multiple structural biology approaches can be applied to membrane proteins like CMS0846, each with particular advantages:

TechniqueResolutionSample RequirementsConsiderations for CMS0846
X-ray crystallographyPotentially atomic (1-3 Å)Highly pure, stable crystalsChallenging for membrane proteins; requires extensive detergent screening
Cryo-electron microscopy2-4 Å for medium-sized membrane proteinsPurified protein (>100 kDa preferred)Increasingly viable for membrane proteins; consider amphipol or nanodisc reconstitution
NMR spectroscopyAtomic for smaller proteinsIsotope-labeled proteinSuitable for individual domains or smaller membrane proteins
Small-angle X-ray scattering (SAXS)Low resolution (10-20 Å)Monodisperse samplesCan provide envelope shape and complement other methods

For CMS0846 specifically, a hybrid approach might be most informative. Initial computational structure prediction using AlphaFold or RoseTTAFold, followed by experimental validation through cryo-EM or X-ray crystallography of the full protein or domain-focused NMR studies. Consider reconstitution in nanodiscs or lipid cubic phase for mimicking the native membrane environment during structural studies.

How might comparative genomics across Clavibacter subspecies inform CMS0846 function?

Comparative genomic analysis across Clavibacter subspecies can provide crucial insights into CMS0846 function:

  • Identify orthologs across subspecies with different host ranges

  • Analyze sequence conservation patterns

  • Detect evidence of selective pressure (dN/dS ratio)

  • Compare genomic context and potential operon structures

Studies of Clavibacter michiganensis have demonstrated that genomic analysis can reveal host range determinants, as seen with the chpG effector gene where allelic variations influence host specificity . By comparing CMS0846 sequences across subspecies that infect different hosts, researchers might identify sequence variations correlating with host preference or virulence characteristics.

A systematic approach would include:

  • Whole genome sequencing of multiple isolates

  • Identification of CMS0846 orthologs

  • Multiple sequence alignment

  • Analysis of variable regions

  • Correlation of sequence features with phenotypic data

This approach has successfully identified the role of the chp/tomA pathogenicity island in tomato virulence and revealed how specific allelic variants of chpG determine the ability to infect eggplant .

What are the most promising future research directions for understanding CMS0846 function?

Based on current knowledge of Clavibacter biology and membrane proteins, several research directions hold particular promise:

  • Functional genomics: Systematic gene deletion and complementation studies to determine the phenotypic consequences of CMS0846 loss and the ability of variants to restore function.

  • Interactome mapping: Comprehensive identification of protein interaction partners to place CMS0846 within bacterial cellular networks.

  • Structural biology: Determination of three-dimensional structure to inform mechanistic understanding of function.

  • Host-pathogen interface: Investigation of potential roles in plant-microbe interactions, particularly in the context of virulence and host specificity.

  • Comparative biology: Analysis of CMS0846 homologs across bacterial species to identify conserved functional properties.

The integration of these approaches, combined with advancing genetic tools for Clavibacter species including markerless deletion systems , will likely provide comprehensive insights into the biological role of this UPF0060 family membrane protein in bacterial physiology and pathogenesis. Particularly promising is the application of recently developed genetic manipulation techniques that allow precise genomic modifications in previously challenging bacterial systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.