Recombinant Clavispora lusitaniae Altered inheritance of mitochondria protein 11 (AIM11)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Clavispora lusitaniae Altered Inheritance of Mitochondria Protein 11 (AIM11)

Clavispora lusitaniae, also known as Candida lusitaniae, is a yeast species known for its ability to quickly develop resistance to the antifungal amphotericin B . Recombinant Altered Inheritance of Mitochondria Protein 11 (AIM11) refers to a biotechnologically produced version of the AIM11 protein from C. lusitaniae . AIM11 is involved in mitochondrial inheritance .

Role of AIM11

AIM11 is a protein that plays a role in the inheritance of mitochondria . Mitochondria are essential organelles responsible for energy production within cells, and their proper distribution during cell division is crucial for maintaining cellular health and function.

Recombinant Production

Recombinant AIM11 is produced using genetic engineering techniques, where the gene encoding AIM11 from C. lusitaniae is inserted into a host organism (e.g., Escherichia coli) to produce the protein in large quantities . The Saccharomyces cerevisiae recombinant form of the protein consists of 1-137 amino acids and is fused to an N-terminal His tag, and expressed in E. coli . Similarly, the Meyerozyma guilliermondii form consists of 1-155 amino acids and is fused to an N-terminal His tag, and expressed in E. coli .

Significance of Clavispora lusitaniae

C. lusitaniae is an opportunistic fungal pathogen that can cause invasive infections, particularly in immunocompromised individuals . One notable characteristic of C. lusitaniae is its propensity to develop resistance to amphotericin B, a commonly used antifungal drug . Studying proteins like AIM11 in C. lusitaniae can offer insights into its biology and potential vulnerabilities.

Drug Resistance Mechanisms in C. lusitaniae

C. lusitaniae's ability to develop drug resistance involves complex mechanisms, including the overexpression of genes regulated by the transcription factor Mrr1 . Mrr1 regulates the expression of genes such as MDR1, which encodes a multidrug efflux pump that confers resistance to azoles like fluconazole . Studies have shown that mutations in MRR1 can lead to altered Mrr1 activity, affecting the expression of drug resistance genes and influencing the fungus's response to antifungal treatments .

Mrr1 Activity and Antifungal Resistance

Research indicates that different mutations in MRR1 can result in varying levels of Mrr1 activity, impacting the minimum inhibitory concentration (MIC) of antifungal drugs . For instance, deleting MRR1 in certain strains of C. lusitaniae has been shown to increase fluconazole MIC, suggesting a complex relationship between Mrr1 activity and drug resistance . The expression of genes like MGD1 and FLU1, which are regulated by Mrr1, also plays a role in antifungal resistance .

Role of Oxidative Stress

The interplay between Mrr1 activity and resistance to oxidative stress has been observed in C. lusitaniae . Strains with high Mrr1 activity are more sensitive to oxidative stress, indicating a trade-off between antifungal resistance and the ability to withstand oxidative damage . Environmental factors, such as the presence of hydrogen peroxide, can influence the selection of C. lusitaniae isolates with different Mrr1 activity levels .

lusitaniae Cell Wall Hydrophobicity

Compared to Candida albicans, C. lusitaniae exhibits higher cell wall hydrophobicity, which may contribute to its virulence and ability to adhere to host tissues .

Tables related to Mrr1 Activity and Antifungal Resistance

The following data exemplifies the relationship between Mrr1 and antifungal resistance:

GeneDescription
MDR1Multidrug efflux pump; its expression correlates with fluconazole MIC for different Mrr1 variants
MGD1Methylglyoxal reductase; regulated by Mrr1; its expression correlates with MDR1
MGD2C. lusitaniae gene shown to be Mrr1-regulated; its expression correlates with MDR1
FLU1Multidrug efflux pump; expression is significantly higher in strains encoding constitutively active Mrr1

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AIM11; CLUG_01354; Altered inheritance of mitochondria protein 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Clavispora lusitaniae (strain ATCC 42720) (Yeast) (Candida lusitaniae)
Target Names
AIM11
Target Protein Sequence
MDLLRQYNFKIADASPEYLERRKKQAVLFMTAAAVTIFTSRFAYKSTITRQYIPTLFQGN HSPPLGYNFTSDAAVAVGTGTMLCASVSSMICFGTCWVLDVSTFREFGWKMKSLMGGTQK EQELADMPMDEDSAYIQDGLNDILDGKVELNFDDE
Uniprot No.

Target Background

Database Links
Protein Families
AIM11 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Clavispora lusitaniae and why is it important in clinical research?

Clavispora lusitaniae (formerly known as Candida lusitaniae) is an opportunistic human pathogen responsible for approximately 0.6 to 2% of candidemia cases. This species has gained significant attention in the clinical setting due to its potential to develop multidrug resistance, particularly to amphotericin B (AmB) during treatment. The first reported case of C. lusitaniae infection occurred in March 1979 in a patient who had undergone a bone marrow transplant, and notably, the isolate developed resistance to AmB during antifungal therapy . While intrinsic resistance to antifungals is relatively rare in this species, secondary resistance may develop during treatment due to phenotypic rearrangement and reorganization of the cell wall . Additionally, C. lusitaniae has demonstrated the ability to develop resistance to echinocandins, a class of antifungals to which it is intrinsically susceptible, creating further clinical challenges . Understanding this organism's biology, including specialized proteins like AIM11, is critical for addressing its pathogenicity and evolving resistance mechanisms.

How does C. lusitaniae AIM11 compare with similar proteins in related Candida species?

While comprehensive comparative studies specifically focused on AIM11 across Candida species are not extensively documented in the current literature, we can make some informed comparisons based on available information. In Candida albicans, which is phylogenetically related to C. lusitaniae, the AIM11 protein is also present, suggesting conservation of this mitochondrial protein across the Candida genus . The C. albicans AIM11 protein has been characterized as part of the mitochondrial proteome and is believed to function in mitochondrial inheritance and dynamics. The C. albicans genome is approximately 16 Mb for the haploid size and consists of 8 chromosome pairs, containing 6,198 Open Reading Frames (ORFs), 70% of which have not yet been fully characterized . This suggests that proteins like AIM11 represent understudied components of fungal biology.

When comparing the specific AIM11 proteins, C. lusitaniae AIM11 consists of 155 amino acids , while the C. albicans counterpart comprises 165 amino acids . This difference in length might reflect functional adaptations specific to each species. Sequence alignment analysis would likely reveal conserved domains critical for mitochondrial function as well as species-specific regions that may contribute to the distinctive biology of each organism. These differences could potentially relate to the documented physiological variability between Candida species, particularly in areas such as growth rates, stress responses, and potentially drug susceptibility profiles. Further comparative genomic and proteomic studies are needed to fully elucidate the evolutionary relationships and functional divergences of AIM11 among Candida species.

What expression systems are optimal for producing recombinant C. lusitaniae AIM11 protein?

The choice of expression system for recombinant C. lusitaniae AIM11 protein production depends on research objectives, required protein quantity, and downstream applications. Based on available information, E. coli has been successfully used to express the full-length C. lusitaniae AIM11 protein (amino acids 1-155) with an N-terminal His tag . This bacterial expression system offers several advantages for basic research applications:

  • E. coli expression protocol: Culture transformed E. coli in LB medium supplemented with appropriate antibiotics at 37°C until OD600 reaches 0.6-0.8. Induce protein expression with IPTG (typically 0.5-1 mM) and continue cultivation at 16-25°C for 16-20 hours to minimize inclusion body formation. The lower temperature during induction often improves the solubility of heterologous proteins.

  • Optimization considerations: Several parameters can be adjusted to improve yield and solubility:

    • IPTG concentration (0.1-1.0 mM)

    • Induction temperature (16-37°C)

    • Induction duration (4-24 hours)

    • Media composition (standard LB vs. enriched media like TB or 2YT)

    • Co-expression with chaperones may improve folding

For more advanced applications requiring post-translational modifications or enhanced solubility, alternative expression systems should be considered:

  • Yeast expression systems (S. cerevisiae or P. pastoris): These may provide a more suitable eukaryotic environment for proper folding and post-translational modifications of fungal proteins. For mitochondrial proteins, yeast systems often yield more functionally relevant products.

  • Baculovirus expression in insect cells: While more complex and expensive, this system can accommodate larger proteins and provide more extensive eukaryotic post-translational modifications.

The optimal purification approach would typically involve immobilized metal affinity chromatography (IMAC) utilizing the His-tag, followed by size exclusion chromatography to achieve high purity. Functional assays should be conducted post-purification to verify that the recombinant protein retains its native structure and activity.

What analytical methods are most effective for studying AIM11 structure and function?

Investigating the structure and function of recombinant C. lusitaniae AIM11 protein requires a multi-technique approach:

  • Structural characterization:

    • Circular Dichroism (CD) Spectroscopy: Essential for determining secondary structure composition (α-helices, β-sheets, random coils). Measurements should be performed in the far-UV range (190-260 nm) with protein concentrations of 0.1-0.5 mg/mL in a buffer compatible with CD analysis (low or no chloride ions).

    • X-ray Crystallography: For high-resolution 3D structure determination, requiring purified protein at concentrations exceeding 10 mg/mL and extensive crystallization condition screening.

    • Nuclear Magnetic Resonance (NMR): Suitable for solution-state structural analysis of smaller proteins (<30 kDa), providing information on protein dynamics in addition to structure.

  • Functional analysis:

    • Mitochondrial localization studies: Using fluorescence microscopy with GFP-tagged AIM11 or immunofluorescence techniques to confirm mitochondrial targeting in fungal cells.

    • Respirometry assays: Oxygen consumption measurements in wild-type versus AIM11-depleted cells can assess impact on mitochondrial respiration.

    • Mitochondrial inheritance assays: Time-lapse microscopy of dividing cells with fluorescently labeled mitochondria to evaluate proper distribution during cell division in the presence/absence of functional AIM11.

  • Interaction studies:

    • Co-immunoprecipitation: To identify protein-protein interactions with potential binding partners in the mitochondrial network.

    • Yeast two-hybrid screening: For unbiased identification of potential interaction partners.

    • Surface Plasmon Resonance (SPR): For quantitative measurement of binding kinetics with suspected interaction partners.

  • Phenotypic characterization of AIM11 mutants:

    • Growth rate analysis under various stress conditions

    • Mitochondrial morphology assessment

    • Antifungal susceptibility testing

When designing these experiments, researchers should be mindful that mitochondrial proteins often require specific conditions to maintain native conformation and function. Inclusion of appropriate controls, such as known mitochondrial proteins with established functions, is essential for meaningful interpretation of results.

How can gene expression analysis be optimized for studying AIM11 in clinical isolates?

Studying AIM11 gene expression in clinical isolates of C. lusitaniae requires careful consideration of methodology to accommodate potential strain variability and the challenges of working with clinical specimens. The following approach is recommended:

  • Sample collection and processing:

    • Collect clinical isolates from diverse sources (blood, tissue, mucosal surfaces)

    • Confirm species identification using both phenotypic methods and molecular techniques (ITS sequencing)

    • Document clinical parameters including patient demographics, antifungal exposure, and treatment outcomes

    • Establish pure cultures and standardize growth conditions prior to RNA extraction

  • RNA extraction optimization:

    • Use specialized kits designed for yeast RNA extraction with mechanical disruption (e.g., bead-beating)

    • Include RNase inhibitors throughout the extraction process

    • Verify RNA integrity using bioanalyzer analysis (RIN >7 preferred)

    • Treat samples with DNase to eliminate genomic DNA contamination

  • Expression analysis techniques:

    • RT-qPCR protocol: Design primers specific to C. lusitaniae AIM11 with amplicon size of 80-150 bp

      • Reference genes: ACT1, TDH3, and PGK1 have shown stability in Candida species

      • Use minimum of three technical replicates and three biological replicates

      • Include no-RT controls to detect genomic DNA contamination

      • Standard curve with 5-log dynamic range for absolute quantification

    • RNA-Seq approach: Provides comprehensive transcriptomic context

      • Minimum 20 million paired-end reads per sample

      • Include spike-in controls for normalization

      • Consider strand-specific library preparation to distinguish overlapping transcripts

  • Data normalization and analysis:

    • For RT-qPCR: Use geometric mean of multiple reference genes for normalization

    • For RNA-Seq: TMM or DESeq2 normalization methods appropriate for fungal transcriptomes

    • Consider growth phase effects on expression patterns

  • Validation with protein expression:

    • Western blotting with specific antibodies against AIM11

    • If antibodies unavailable, consider epitope tagging strategies in amenable isolates

This methodology should be tailored based on clinical isolate characteristics, as prior research has demonstrated significant physiological differences between C. lusitaniae strains , which may extend to gene expression patterns. Additionally, monitoring expression under various stress conditions, particularly exposure to subinhibitory concentrations of antifungals, may reveal important regulatory patterns relevant to resistance development.

What is the potential role of AIM11 in antifungal resistance mechanisms?

The potential role of AIM11 in antifungal resistance mechanisms in C. lusitaniae represents an intriguing yet underexplored research area. While direct evidence specifically linking AIM11 to antifungal resistance is limited in current literature, several hypotheses can be proposed based on known mitochondrial functions and resistance mechanisms:

  • Mitochondrial involvement in echinocandin resistance: C. lusitaniae can develop resistance to echinocandins during caspofungin treatment, primarily through mutations in the Fks1 gene . Mitochondrial proteins like AIM11 may influence this process through:

    • Stress response signaling pathways that coordinate cell wall remodeling

    • Metabolic adaptations that compensate for cell wall stress

    • Energy provision for drug efflux mechanisms

  • Potential mechanisms in amphotericin B resistance: C. lusitaniae is known for its propensity to develop amphotericin B resistance during therapy . Given that AmB targets ergosterol in fungal membranes, mitochondrial proteins might contribute to resistance via:

    • Alterations in sterol biosynthesis pathways, which involve mitochondrial components

    • Changes in membrane composition affecting drug binding

    • Mitochondrial adaptive responses to oxidative stress induced by AmB

  • Experimental evidence from resistance development: In clinical cases, C. lusitaniae isolates developed increased echinocandin MICs within two weeks of caspofungin treatment, exhibiting the S645F missense mutation in the HS1 region of the Fks1 gene . The rapid timeline suggests coordinated cellular adaptation mechanisms in which mitochondrial function may play a supporting role.

  • Mitochondrial adaptation and strain variability: Significant physiological and resistance differences have been observed between C. lusitaniae strains , which may reflect underlying variation in mitochondrial function. This strain variability could potentially include differences in AIM11 expression or function.

To investigate these hypotheses, researchers could:

  • Compare AIM11 expression levels between susceptible and resistant isolates

  • Generate AIM11 knockout or overexpression strains and assess changes in antifungal susceptibility

  • Perform mitochondrial functional assays in the presence of various antifungals

  • Investigate potential interactions between AIM11 and known resistance-associated proteins

Understanding the role of mitochondrial proteins like AIM11 in antifungal resistance could reveal novel targets for combination therapies aimed at preventing resistance development in clinical settings.

How might AIM11 contribute to C. lusitaniae pathogenicity and virulence?

The contribution of AIM11 to C. lusitaniae pathogenicity and virulence remains largely unexplored, but several potential mechanisms can be proposed based on our understanding of fungal pathogenesis and mitochondrial function:

  • Metabolic adaptation during infection: Pathogenic fungi must adapt to diverse nutrient environments within the host. Mitochondrial proteins like AIM11 may play crucial roles in:

    • Metabolic switching between fermentation and respiration depending on nutrient availability

    • Utilization of alternative carbon sources in nutrient-limited host niches

    • Energy production supporting rapid growth and dissemination

  • Stress response coordination: During infection, C. lusitaniae encounters numerous host-derived stressors, including:

    • Oxidative burst from immune cells

    • Nitrosative stress

    • pH fluctuations

    • Nutrient limitation

    As a mitochondrial protein, AIM11 may contribute to coordinating cellular responses to these stresses, particularly oxidative stress which directly impacts mitochondrial function.

  • Host-pathogen interaction dynamics: Mitochondrial function has been implicated in several virulence mechanisms of pathogenic fungi:

    • Production of virulence factors requiring mitochondrial metabolites

    • Morphological transitions requiring significant energy investment

    • Evasion of host immune recognition

  • Beta-D-glucan production connection: Interestingly, C. lusitaniae strains have demonstrated minimal beta-D-glucan production , suggesting alternative pathogenic mechanisms compared to other Candida species. This characteristic might relate to distinctive mitochondrial functions involving proteins like AIM11.

  • Experimental approaches to evaluate virulence contribution:

    • Generation of AIM11 deletion mutants and assessment in infection models

    • Transcriptomic analysis comparing AIM11 expression during commensal versus invasive growth

    • Co-infection experiments with wild-type and AIM11-mutant strains to assess competitive fitness

The role of AIM11 in pathogenicity may vary between the two major clades of C. lusitaniae identified through ITS-based phylogenetic analysis , potentially contributing to the documented physiological differences between strains. A comparative analysis of AIM11 sequence, expression, and function between representatives of these clades could yield insights into strain-specific virulence mechanisms.

What genetic variation exists in the AIM11 gene across clinical isolates?

Genetic variation in the AIM11 gene across clinical isolates of C. lusitaniae represents an important but understudied aspect of this organism's biology. Based on the available information about C. lusitaniae's genetic diversity, several important considerations can be outlined:

  • Evidence for genetic diversity in C. lusitaniae: C. lusitaniae demonstrates strong variability in the LSU locus (26S), suggesting potential species divergence into two allopatric populations . The Mycobank ITS-based phylogenetic analysis shows two major clades containing the type strains CBS 4413 (h−) and CBS 6936 (h+) . This broad genetic diversity likely extends to individual genes such as AIM11.

  • Expected patterns of AIM11 variation:

    • Intra-clade conservation: Within each major clade, AIM11 sequence may show relatively high conservation in functional domains

    • Inter-clade divergence: Between clades, more substantial sequence variations might be observed, potentially reflecting adaptation to different ecological niches

    • Selective pressure: Genes involved in mitochondrial function may be under purifying selection, limiting non-synonymous mutations in critical regions

  • Methodological approach to characterize variation:

    Analysis MethodPurposeExpected Outcomes
    PCR amplification and sequencingIdentify SNPs and small indelsCatalog of common variants
    Whole genome sequencingComprehensive variation detectionCopy number variation, structural variants
    RNA-SeqExpression variation analysisDifferential expression patterns
    Population genomicsGeographic distribution of variantsEvolutionary relationships
  • Functional implications of variation:

    • Amino acid substitutions in functional domains may affect protein-protein interactions

    • Regulatory region variations could impact expression levels

    • Structural variations may influence protein stability and function

  • Clinical relevance of variation:

    • Potential correlation between specific AIM11 variants and antifungal susceptibility profiles

    • Association between genetic variants and virulence phenotypes

    • Predictive value for treatment outcomes

The study of AIM11 genetic variation should be integrated with the broader context of C. lusitaniae genomic diversity. Given the evidence for significant physiological and resistance differences between C. lusitaniae strains , a systematic analysis of AIM11 sequence variation could provide valuable insights into the molecular basis of these phenotypic differences and potentially identify markers associated with clinically relevant traits.

How can AIM11 be utilized as a potential therapeutic target?

The exploration of AIM11 as a potential therapeutic target for C. lusitaniae infections requires careful consideration of its biological role, structural characteristics, and druggability. While specific information on targeting AIM11 is not extensively documented in current literature, a rational drug discovery approach can be outlined:

  • Target validation strategy:

    • Essentiality assessment: Determine whether AIM11 is essential for C. lusitaniae viability or virulence using gene deletion/silencing approaches

    • Specificity evaluation: Compare C. lusitaniae AIM11 with human mitochondrial proteins to identify fungal-specific features

    • Function verification: Confirm mitochondrial role and potential involvement in stress response or antifungal resistance

  • Structural biology approach:

    • High-resolution structure determination of AIM11 using X-ray crystallography or cryo-EM

    • Identification of potential binding pockets using computational analysis

    • In silico screening of compound libraries against identified binding sites

  • Drug development pipeline:

    Development StageMethodologiesSuccess Criteria
    Hit identificationVirtual screening, fragment-based approachesBinding affinity >10μM
    Hit-to-lead optimizationMedicinal chemistry, structure-activity relationshipImproved potency, selectivity
    Lead optimizationADMET studies, in vitro efficacyMIC <1μg/ml, selectivity index >10
    Preclinical testingAnimal models of infectionEfficacy with acceptable toxicity profile
  • Alternative therapeutic strategies:

    • Peptide inhibitors: Designed to disrupt AIM11 protein-protein interactions

    • Antisense therapies: Targeting AIM11 mRNA to reduce expression

    • Combination approaches: Targeting AIM11 alongside conventional antifungals to prevent resistance

  • Challenges and considerations:

    • Mitochondrial proteins may have conserved features across species, raising selectivity concerns

    • Delivery of inhibitors to the mitochondrial compartment presents pharmacokinetic challenges

    • Resistance development through compensatory mechanisms must be anticipated

What diagnostic applications might utilize AIM11 detection or characterization?

Developing diagnostic applications based on AIM11 detection or characterization presents several intriguing possibilities for improving C. lusitaniae identification and characterization in clinical settings:

  • Species-specific molecular identification:

    • PCR-based detection: Design of primers targeting unique regions of the C. lusitaniae AIM11 gene for rapid, specific identification

    • LAMP assays: Development of isothermal amplification methods for point-of-care testing with minimal equipment requirements

    • Multiplex PCR panels: Integration of AIM11 detection into fungal pathogen panels distinguishing various Candida species

  • Strain typing and epidemiological tracking:

    • Sequence-based typing: Using AIM11 sequence variations to distinguish between the two major clades of C. lusitaniae

    • MLST incorporation: Addition of AIM11 to multi-locus sequence typing schemes for enhanced discrimination

    • Outbreak investigation: Tracking strain-specific variants during nosocomial transmission events

  • Predictive diagnostics for drug resistance:

    • If correlations between AIM11 variants and resistance phenotypes are established, genetic testing could predict susceptibility profiles

    • Development of rapid tests for resistance-associated AIM11 variants to guide therapy selection

    • Integration with other resistance markers (e.g., Fks1 mutations ) for comprehensive resistance profiling

  • Functional diagnostic assays:

    • Expression-based tests: Quantification of AIM11 expression as a potential biomarker for virulence or drug response

    • Protein detection: Development of antibody-based assays to detect AIM11 protein in clinical samples

    • Activity assays: If specific enzymatic activity is identified, functional assays could assess protein activity

  • Technological implementation approaches:

    Diagnostic PlatformAdvantagesLimitationsApplication Scenario
    Real-time PCRHigh sensitivity, quantitativeRequires thermal cyclerReference laboratory
    MicroarrayMultipathogen detectionComplex data analysisEpidemiological surveillance
    MALDI-TOF MSRapid identificationLimited strain discriminationHospital laboratory
    NGSComprehensive genetic analysisTime, cost, expertiseResearch, outbreak investigation
    Lateral flowPoint-of-care, minimal trainingLower sensitivityField testing, screening

The development of AIM11-based diagnostics would benefit from further research establishing the degree of sequence conservation within species and divergence from other Candida species. Additionally, understanding the relationship between AIM11 characteristics and clinically relevant phenotypes (e.g., virulence, drug resistance) would enhance the diagnostic utility of this molecular target. Given the documented physiological and resistance differences between C. lusitaniae strains , AIM11-based approaches could potentially contribute to more precise characterization of clinical isolates, supporting personalized treatment strategies.

What are the current limitations in studying C. lusitaniae AIM11 protein?

Research on C. lusitaniae AIM11 protein faces several significant challenges that impact our understanding of its structure, function, and clinical relevance:

  • Limited genomic and proteomic resources:

    • Absence of comprehensive genomic studies focusing specifically on C. lusitaniae

    • Incomplete annotation of the C. lusitaniae genome compared to more studied species like C. albicans

    • Lack of standardized proteomic databases for accurate identification and quantification

    • Limited availability of genetic manipulation tools optimized for C. lusitaniae

  • Technical challenges in mitochondrial protein research:

    • Difficulty in isolating pure, functional mitochondria from fungal cells

    • Challenges in maintaining proper folding and activity of mitochondrial proteins when expressed recombinantly

    • Limited availability of specific antibodies against C. lusitaniae AIM11

    • Complex regulation of mitochondrial proteins involving both nuclear and mitochondrial genetic systems

  • Strain variability complications:

    • Evidence of significant physiological differences between C. lusitaniae strains

    • Potential variation in AIM11 sequence, expression, and function between the two major clades

    • Lack of standardized reference strains for comparative studies

    • Limited typing methods for C. lusitaniae, complicating genetic relatedness analysis

  • Knowledge gaps in basic biology:

    • Incomplete understanding of C. lusitaniae mitochondrial biology compared to model yeasts

    • Unclear relationship between mitochondrial function and antifungal resistance mechanisms

    • Limited information on protein-protein interactions involving AIM11

    • Insufficient data on the role of AIM11 in stress response and pathogenesis

  • Translational research barriers:

    • Difficulty in establishing clinically relevant models for studying C. lusitaniae infections

    • Limited correlation between in vitro findings and in vivo relevance

    • Challenges in distinguishing strain-specific from species-wide characteristics

    • Ethical and practical limitations in studying emerging resistance in clinical settings

These limitations underscore the need for foundational research on C. lusitaniae biology in general and AIM11 in particular. Addressing these challenges requires interdisciplinary approaches combining genomics, proteomics, structural biology, and clinical microbiology to build a comprehensive understanding of this protein's role in fungal biology and pathogenesis.

What emerging technologies could advance AIM11 research?

Several cutting-edge technologies hold promise for overcoming current limitations and accelerating research on C. lusitaniae AIM11:

  • Advanced genomic and transcriptomic approaches:

    • Long-read sequencing technologies (Oxford Nanopore, PacBio): Enable more complete genome assembly and identification of structural variants affecting AIM11

    • Single-cell RNA-seq: Reveals cell-to-cell variability in AIM11 expression within heterogeneous populations

    • Spatial transcriptomics: Maps AIM11 expression patterns in biofilms or infected tissues

    • CRISPR-Cas9 genome editing: Facilitates precise genetic manipulation of AIM11 in C. lusitaniae

  • Innovative protein characterization methods:

    • Cryo-electron microscopy: Determines high-resolution structures of AIM11 without crystallization

    • Hydrogen-deuterium exchange mass spectrometry: Maps protein dynamics and interaction surfaces

    • Protein painting: Identifies functional domains and interaction sites

    • Native mass spectrometry: Analyzes intact protein complexes containing AIM11

  • Advanced cellular and subcellular imaging:

    • Super-resolution microscopy: Visualizes AIM11 localization and dynamics within mitochondria at nanoscale resolution

    • Live-cell FRET imaging: Monitors real-time protein-protein interactions involving AIM11

    • Correlative light and electron microscopy: Combines functional and ultrastructural information

    • Mass spectrometry imaging: Maps AIM11 distribution in fungal cells during different growth phases

  • High-throughput functional screening platforms:

    • CRISPR interference/activation screens: Identifies genetic interactions with AIM11

    • Chemical genomics: Discovers small molecules targeting AIM11 or related pathways

    • Synthetic genetic array analysis: Maps genetic interaction networks involving AIM11

    • Microfluidic single-cell analysis: Characterizes phenotypic consequences of AIM11 variation

  • Integrative computational approaches:

    • AlphaFold2 and related AI tools: Predicts AIM11 structure with high accuracy

    • Molecular dynamics simulations: Models dynamic behavior of AIM11 in mitochondrial environment

    • Systems biology modeling: Integrates AIM11 into broader mitochondrial function networks

    • Machine learning algorithms: Identifies patterns correlating AIM11 variants with phenotypic outcomes

These technologies, particularly when used in combination, could rapidly advance our understanding of AIM11 biology. For example, integrating structural predictions from AlphaFold2 with experimental validation using cryo-EM could accelerate structure determination, while combining CRISPR-based functional genomics with high-resolution imaging could reveal AIM11's role in mitochondrial dynamics during antifungal stress response. Such integrated approaches would help overcome the current limitations in studying this important but understudied protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.