Recombinant Clavispora lusitaniae Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RCF1; AIM31; CLUG_03615; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Clavispora lusitaniae (strain ATCC 42720) (Yeast) (Candida lusitaniae)
Target Names
RCF1
Target Protein Sequence
MNTLQKIAYRSKQQPLVPLGTLLTTAAVVLAAKSLKQGRKKDTQRYFRYRVGFQAFTLVA LVIGGMYYQKESAEQKQTREDKLREKAKLREQLWIEELERRDQLIKARKQRLEESKKELM KVAQEGFEQERERELKKEDK
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.

Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is AIM31 in Clavispora lusitaniae and what is its basic function?

AIM31 (Altered inheritance of mitochondria protein 31) in C. lusitaniae is a mitochondrial protein involved in regulating mitochondrial inheritance patterns. Based on comparative genomic analyses, AIM31 (also known as RCF1) appears to be conserved across fungal species and plays a critical role in mitochondrial function and inheritance mechanisms .

The protein is encoded by the nuclear genome but localizes to mitochondria, where it influences mitochondrial DNA transmission patterns. In C. lusitaniae, a haploid opportunistic yeast pathogen, proper mitochondrial function is essential for virulence, resistance to oxidative stress, and potentially antifungal resistance mechanisms .

How does C. lusitaniae AIM31 differ structurally from homologs in other fungal species?

C. lusitaniae AIM31 (Uniprot No. C4Y631) shares structural similarities with homologs in other fungi, including Saccharomyces cerevisiae (Uniprot No. A6ZM32) and Penicillium marneffei (Uniprot No. B6QHL9) . While the specific amino acid sequence of C. lusitaniae AIM31 is unique, functional domains are conserved.

Comparative analysis between these homologs reveals:

SpeciesProtein LengthKey Structural FeaturesUniProt Identifier
Clavispora lusitaniaePartial (exact length varies)Mitochondrial targeting sequenceC4Y631
Saccharomyces cerevisiae159 amino acidsComplete sequence with extended C-terminal regionA6ZM32
Penicillium marneffei167 amino acidsComplete sequence with distinctive N-terminal domainB6QHL9

The evolutionary conservation of this protein across diverse fungal species indicates its fundamental importance in mitochondrial biology .

What are the recommended storage and handling conditions for recombinant C. lusitaniae AIM31?

For optimal stability and activity of recombinant C. lusitaniae AIM31:

  • Store lyophilized protein at -20°C/-80°C for up to 12 months

  • Store reconstituted protein at -20°C/-80°C for up to 6 months

  • Add 5-50% glycerol (final concentration) when reconstituting for long-term storage

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week

These conditions are essential for maintaining protein integrity during experimental procedures, particularly for functional studies examining mitochondrial inheritance patterns.

What experimental approaches are recommended for studying AIM31 function in mitochondrial inheritance?

To investigate AIM31 function in C. lusitaniae mitochondrial inheritance, researchers should consider these methodological approaches:

  • Gene deletion and complementation studies: Generate AIM31 knockout strains followed by phenotypic characterization and complementation with wild-type or mutant alleles to assess functional consequences .

  • Fluorescent tagging and microscopy: Employ fluorescent protein fusions to track AIM31 localization and dynamics during mitochondrial inheritance, particularly during cell division .

  • Heterologous expression systems: Express C. lusitaniae AIM31 in S. cerevisiae aim31Δ mutants to assess functional conservation across species .

  • Mitochondrial DNA tracking: Develop systems to track paternal versus maternal mitochondrial DNA, similar to the approach used in Drosophila studies where researchers "utilized two D. melanogaster strains... designated mt:CoIts" to track mitochondrial inheritance patterns .

  • Respiratory chain activity assays: Measure mitochondrial respiratory chain complex IV activity to assess functional consequences of AIM31 manipulation, as demonstrated in studies of paternal mitochondrial inheritance .

How does AIM31 potentially influence C. lusitaniae pathogenicity and antifungal resistance?

While direct evidence linking AIM31 to pathogenicity is limited, research suggests potential involvement through several mechanisms:

  • Mitochondrial function regulation: Proper mitochondrial function is crucial for C. lusitaniae virulence and stress response. As evidenced in related species, mitochondrial dysfunction can alter susceptibility to oxidative stress produced by host immune cells .

  • Amphotericin B resistance: C. lusitaniae is known for "its propensity to develop amphotericin B resistance during therapy" . Mitochondrial proteins like AIM31 may influence this resistance by modulating ergosterol biosynthesis, as "AmB resistance in fungal pathogens is usually caused by mutations in the ergosterol biosynthesis pathway" .

  • Multidrug resistance development: C. lusitaniae can rapidly develop resistance to "all known antifungal agents" . Mitochondrial function, potentially regulated by AIM31, may play a role in this remarkable adaptability.

  • Oxidative stress response: Research has shown an inverse relationship between antifungal resistance and hydrogen peroxide resistance in C. lusitaniae, suggesting mitochondrial involvement in balancing these phenotypes .

What is the relationship between mitochondrial inheritance patterns and antifungal susceptibility in C. lusitaniae?

The connection between mitochondrial inheritance and antifungal susceptibility in C. lusitaniae appears complex:

  • C. lusitaniae exhibits "high-frequency, in vitro reversible switching" from amphotericin B susceptibility to resistance . This phenotypic switching might involve altered mitochondrial function.

  • Unlike most species with strict maternal inheritance of mitochondria, evidence from other organisms suggests that under certain conditions—particularly when "maternal mitochondria are dysfunctional"—paternal mitochondria can be retained and functionally inherited .

  • This unusual inheritance pattern may contribute to the rapid evolution of drug resistance in C. lusitaniae populations, as demonstrated by genomic studies showing multiple resistance mechanisms emerging in clinical isolates .

  • Research in Drosophila showed that "paternal mitochondrial inheritance should not be overlooked as a genetic phenomenon in evolution, especially when paternal mitochondria are of significant differences from the maternal mitochondria or the maternal mitochondria are functionally abnormal" . This principle may apply to C. lusitaniae as well.

How does the unusual centromere structure of C. lusitaniae potentially interact with mitochondrial inheritance mechanisms?

C. lusitaniae possesses unusual centromeres that "lack pericentromeric heterochromatin" , a feature that distinguishes it from related yeast species. This unique genomic architecture may have implications for mitochondrial inheritance and AIM31 function:

  • The centromeres of C. lusitaniae span 4-4.5 kbp with unique sequences and lack heterochromatin formation capacity .

  • This unusual chromosome organization may influence nuclear-mitochondrial communication, potentially affecting how nuclear-encoded mitochondrial proteins like AIM31 regulate mitochondrial inheritance.

  • The absence of heterochromatin-forming capacities in C. lusitaniae suggests alternative regulatory mechanisms for genome stability , which may extend to mitochondrial genome maintenance.

  • Researchers studying AIM31 should consider this unique genomic feature when designing experiments, as it may influence experimental outcomes compared to model organisms with conventional centromere structures.

What experimental strategies would be most effective for investigating the role of AIM31 in mitochondrial inheritance under stress conditions?

To investigate AIM31's role under stress conditions relevant to pathogenicity, consider these advanced approaches:

  • Stress-induced mitochondrial inheritance tracking: Design experiments similar to those in Drosophila where researchers found that "when maternal mitochondria are dysfunctional," paternal mitochondria can be transmitted . Create conditions of mitochondrial stress (oxidative, antifungal exposure) and track mitochondrial inheritance patterns.

  • Comparative genomics across clinical isolates: Analyze AIM31 sequence variation in clinical isolates with different antifungal resistance profiles. Genomic studies of C. lusitaniae have revealed "the rapid development of MDR in C. lusitaniae in a patient, which became resistant to all known antifungal agents" .

  • Integration with MRR1 pathway studies: Research has shown that C. lusitaniae isolates with high MRR1 activity (fluconazole resistant) were more sensitive to hydrogen peroxide . Investigate potential interactions between AIM31-regulated mitochondrial function and MRR1-regulated stress responses.

  • Metabolic profiling: Employ metabolomics to characterize changes in mitochondrial metabolism when AIM31 is disrupted, particularly focusing on ergosterol biosynthesis pathways implicated in amphotericin B resistance .

  • In vivo infection models: Use appropriate animal models to assess the role of AIM31 in virulence and persistence during antifungal therapy, monitoring potential phenotypic switching events similar to those observed in clinical settings where "the C. lusitaniae population shifted back and forth between being dominated by isolates with higher H₂O₂ resistance or higher FLZ resistance" .

What are the most appropriate methods for assessing AIM31-dependent phenotypes in C. lusitaniae?

To effectively evaluate AIM31-dependent phenotypes:

  • Respiratory function assays: Measure oxygen consumption rates and mitochondrial membrane potential to assess basic mitochondrial function in wild-type versus AIM31-disrupted strains.

  • Antifungal susceptibility testing: Employ standardized protocols to determine MIC values for different antifungal classes, particularly focusing on amphotericin B and echinocandins, where C. lusitaniae shows notable resistance patterns .

  • Oxidative stress resistance: Quantify growth in the presence of hydrogen peroxide (1-4 mM), as studies have shown this is a relevant phenotype in clinical isolates with different drug resistance profiles .

  • Mitochondrial genome stability assessment: Develop PCR-based assays to detect mitochondrial DNA rearrangements or heteroplasmy, similar to techniques used in the Drosophila study where researchers "quantified the D. yakuba mtDNA content by qPCR" .

  • Phenotypic switching frequency measurements: Given C. lusitaniae's ability to switch between antifungal-resistant and susceptible phenotypes, quantify switching rates under different conditions to assess AIM31's potential role in this process .

How can researchers effectively distinguish between direct and indirect effects of AIM31 manipulation on antifungal resistance?

Distinguishing direct from indirect effects requires sophisticated experimental design:

  • Temporal analysis: Monitor changes in gene expression, protein localization, and phenotypes at various time points after AIM31 disruption or overexpression to establish causality.

  • Pathway-specific reporters: Develop fluorescent or enzymatic reporters for key pathways (ergosterol biosynthesis, efflux pump activity) to monitor real-time changes following AIM31 manipulation.

  • Genetic interaction mapping: Perform systematic double-knockout studies combining AIM31 deletion with disruption of known resistance factors (e.g., MDR1, FKS1) to identify epistatic relationships .

  • Biochemical validation: Directly measure AIM31 protein interactions with components of resistance pathways using co-immunoprecipitation or proximity labeling techniques.

  • Heterologous expression systems: Express C. lusitaniae AIM31 in model organisms where mitochondrial inheritance mechanisms are well-characterized to isolate its specific functions from the complex background of C. lusitaniae.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.