Recombinant Clavispora lusitaniae Golgi to ER traffic protein 1 (GET1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GET1; CLUG_00781; Golgi to ER traffic protein 1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Clavispora lusitaniae (strain ATCC 42720) (Yeast) (Candida lusitaniae)
Target Names
GET1
Target Protein Sequence
MFELQPSSIVVLVFCVLAIKVCISLIGKTTIQDRIWYLYTIGASKAGHSKFVALAQKREE LVRVNKERRAISAQDEYAKWTKLNRQFDKLNSEVNDLAEATSSEKAQISKLVNLAIAATT TAPIWFSRIWYRKVVLFYLPPKVFPYYIEWVLALPFIVTGGVGLTVWMFALNSVLSSLEF LIKFYLEEPVKKPEAPAASEAQTKQ
Uniprot No.

Target Background

Function
Recombinant *Clavispora lusitaniae* Golgi to ER traffic protein 1 (GET1) is essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). In conjunction with GET2, it functions as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of ER-resident proteins (possessing a C-terminal H-D-E-L retention signal) from the Golgi apparatus back to the ER.
Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the function of GET1 in Clavispora lusitaniae and how does it compare to homologs in other fungal species?

GET1 functions as a membrane receptor component of the Guided Entry of Tail-anchored proteins (GET) pathway, which mediates the insertion of tail-anchored proteins into the endoplasmic reticulum membrane. In C. lusitaniae, GET1 forms a complex with GET2 that serves as the membrane receptor for the GET3-substrate complex.

To investigate GET1 conservation between species:

  • Perform phylogenetic analyses comparing C. lusitaniae GET1 with homologs from other Candida species

  • Generate multiple sequence alignments to identify conserved domains

  • Use structural prediction software to model the transmembrane domains

Recent studies of stress responses in C. lusitaniae reveal complex adaptation mechanisms to various cellular stressors, suggesting GET1 may play a similar critical role in ER homeostasis as observed in other species .

How does GET1 contribute to ER stress responses in Clavispora lusitaniae?

GET1 likely contributes to ER stress responses by ensuring proper insertion of tail-anchored proteins involved in the Unfolded Protein Response (UPR). While GET1 itself hasn't been specifically characterized in C. lusitaniae ER stress, related ER stress research in Candida species provides context:

  • The ER stress-induced UPR pathway in Candida species is comprised of the conserved ER-resident transmembrane protein kinase Ire1 and downstream transcription factors

  • When ER homeostasis is disrupted, the UPR is activated to restore balance by:

    • Increasing chaperone production

    • Expanding ER volume

    • Upregulating ER-associated degradation

  • Dysfunction in GET pathway proteins likely exacerbates ER stress by causing mislocalization of tail-anchored proteins

Research methodology:

  • Compare expression profiles of GET1 under normal conditions versus various ER stressors (tunicamycin, DTT)

  • Generate GET1 deletion mutants and assess their sensitivity to ER stress-inducing agents

  • Monitor UPR activation markers (HAC1 splicing, chaperone induction) in GET1 mutants

What are the optimal conditions for heterologous expression of recombinant C. lusitaniae GET1?

Expressing membrane proteins like GET1 presents unique challenges. Based on established protocols for similar proteins:

Expression system options:

  • E. coli expression system

    • BL21(DE3) or C41/C43(DE3) strains (specialized for membrane proteins)

    • Use vectors with tightly controlled promoters (pET or pBAD series)

    • Optimal induction: 0.1-0.5 mM IPTG at 18-20°C for 16-20 hours

  • Yeast expression systems

    • S. cerevisiae or P. pastoris systems may provide more native-like processing

    • Use strong inducible promoters (GAL1 for S. cerevisiae; AOX1 for P. pastoris)

    • Include C-terminal purification tags (His6, FLAG) with TEV cleavage sites

Membrane protein solubilization strategies:

  • Detergents: n-Dodecyl-β-D-maltoside (DDM), LMNG, or digitonin

  • Nanodiscs or amphipols for maintaining native-like environment

Optimization protocol:

  • Perform small-scale expression tests varying temperature, inducer concentration, and time

  • Analyze expression by Western blot with anti-tag antibodies

  • Assess membrane localization via fractionation studies

How can recombinant C. lusitaniae GET1 be purified while maintaining protein function?

Purifying membrane proteins requires specialized approaches to maintain structural integrity and function:

Recommended purification workflow:

  • Membrane preparation

    • Lyse cells by mechanical disruption (French press or sonication)

    • Isolate membrane fraction by ultracentrifugation (100,000×g, 1h)

    • Solubilize membranes in buffer containing appropriate detergent

  • Affinity chromatography

    • IMAC (Immobilized Metal Affinity Chromatography) for His-tagged protein

    • Include detergent at CMC in all buffers

    • Elute with imidazole gradient (50-300 mM)

  • Size exclusion chromatography

    • Further purify by SEC using Superdex 200 column

    • Assess protein homogeneity and oligomeric state

  • Functional assessment

    • Reconstitute in proteoliposomes to test GET pathway activity

    • Verify interaction with GET2 and GET3 via pull-down assays

Critical parameters to monitor:

  • Detergent concentration (maintain above CMC)

  • Temperature (maintain at 4°C throughout purification)

  • Buffer composition (pH 7.5-8.0, 150-300 mM NaCl, 5-10% glycerol)

  • Presence of stabilizing agents (cholesterol hemisuccinate for membrane proteins)

What functional assays can be used to verify the activity of purified C. lusitaniae GET1?

To confirm that purified GET1 retains its native function:

In vitro reconstitution assays:

  • Proteoliposome reconstitution

    • Incorporate purified GET1 (with or without GET2) into liposomes

    • Measure binding of fluorescently labeled GET3

    • Quantify using fluorescence anisotropy or microscale thermophoresis

  • ATPase stimulation assay

    • Measure GET3 ATPase activity in presence vs. absence of GET1/GET2 complex

    • Use colorimetric phosphate detection methods (malachite green)

Binding assays:

  • Surface Plasmon Resonance (SPR)

    • Immobilize GET1 on sensor chip

    • Measure binding kinetics with GET3 and substrate proteins

  • Bio-Layer Interferometry (BLI)

    • Alternative to SPR for real-time binding measurements

    • Allows measurement of on/off rates

Structural verification:

  • Circular Dichroism (CD) spectroscopy

    • Verify secondary structure composition

    • Monitor thermal stability

  • Limited proteolysis

    • Assess proper folding by resistance to proteolytic digestion

    • Compare digestion patterns with known functional homologs

How does C. lusitaniae GET1 interact with the HOG pathway during ER stress adaptation?

Recent research in Candida species has revealed cross-talk between ER stress pathways and the High-Osmolarity Glycerol (HOG) MAPK pathway. While specific GET1-HOG interactions aren't yet characterized in C. lusitaniae, evidence suggests potential connections:

  • In C. albicans, Hog1 is activated during the late phase of ER stress response and contributes to UPR attenuation

  • Hog1 phosphorylation during ER stress depends on both functional Ire1 and the Ssk1 mediator branch

  • GET pathway dysfunction may trigger both UPR and HOG pathway activation

Methodological approach to investigate GET1-HOG pathway crosstalk:

  • Generate GET1 deletion or conditional mutants in C. lusitaniae

  • Monitor Hog1 phosphorylation status under ER stress conditions (±GET1)

  • Perform epistasis analysis with double mutants (get1Δ hog1Δ)

  • Use RNA-Seq to compare transcriptional profiles of:

    • Wild-type under ER stress

    • GET1 mutants under normal and stress conditions

    • HOG1 mutants under normal and stress conditions

The results could be analyzed in the context of known HOG pathway functions during stress, such as glycerol production, which shifts protein folding equilibrium toward native conformations .

How do mutations in C. lusitaniae GET1 affect antifungal resistance patterns?

Given the relationship between ER function and stress adaptation in pathogenic fungi, GET1 mutations may influence antifungal susceptibility through several mechanisms:

  • Potential impacts on drug resistance:

    • Altered ER proteostasis affecting ergosterol biosynthesis enzymes

    • Impaired trafficking of multidrug resistance transporters

    • Changes in cell wall composition due to altered secretory pathway

Research methodology to investigate:

  • Generate GET1 variant library:

    • Use site-directed mutagenesis to create point mutations

    • Develop CRISPR-Cas9 system for C. lusitaniae to generate precise genomic edits

  • Assess antifungal susceptibility patterns:

    • Determine MICs using CLSI broth microdilution method

    • Perform time-kill assays for different drug classes

    • Assess synergy between ER stressors and antifungals

  • Correlate with clinical isolate data:

    • Screen clinical C. lusitaniae isolates for GET1 variations

    • Compare MIC data with genotypic changes

Current research on C. lusitaniae has demonstrated its propensity to rapidly develop resistance to multiple antifungal drugs including amphotericin B, azoles, and echinocandins , suggesting complex stress adaptation mechanisms that might involve ER trafficking pathways.

How does GET1-mediated tail-anchored protein insertion interact with the MRR1 regulatory network in C. lusitaniae?

The MRR1 transcription factor has been extensively studied in C. lusitaniae for its role in antifungal resistance and stress responses . Potential interactions with GET1 function could reveal important regulatory connections:

  • MRR1 regulates multiple genes involved in stress response, including:

    • Drug efflux pumps (MDR1, FLU1)

    • Methylglyoxal reductases (MGD1, MGD2)

    • Oxidative stress response genes

  • GET1 dysfunction could potentially trigger compensatory changes in MRR1-regulated pathways

Research approach to investigate interactions:

  • Transcriptomic analysis:

    • Compare RNA-Seq profiles of GET1 mutants vs. wild-type

    • Identify overlaps with known MRR1 regulon

  • Genetic interaction studies:

    • Create GET1 and MRR1 single and double mutants

    • Assess phenotypes under various stress conditions

    • Perform chemical genetic screens

  • Protein localization studies:

    • Determine if any MRR1-regulated proteins are GET pathway substrates

    • Track localization of fluorescently tagged tail-anchored proteins in GET1 and MRR1 mutant backgrounds

This research could reveal whether gain-of-function mutations in MRR1, which confer fluconazole resistance but hydrogen peroxide sensitivity , affect GET pathway function and ER homeostasis in C. lusitaniae.

What role does GET1 play in managing oxidative stress in C. lusitaniae, particularly in clinical settings?

C. lusitaniae isolates show heterogeneity in oxidative stress resistance, particularly regarding hydrogen peroxide sensitivity . GET1 may contribute to this phenotype through:

  • Proper targeting of tail-anchored antioxidant proteins to the ER

  • Maintenance of ER homeostasis during oxidative stress

  • Coordination with other stress response pathways

Table 1. Comparative hydrogen peroxide sensitivity in different C. lusitaniae genetic backgrounds

Genetic BackgroundH₂O₂ ResistanceFLZ ResistanceReference
Wild-typeModerateModerate
MRR1 GOF mutationsLowHigh
MRR1 deletionHighVariable
MDR1 deletionHighLow
GET1 deletion??Not determined

Research methodology:

  • Generate GET1 deletion and conditional expression strains

  • Assess H₂O₂ sensitivity using:

    • Disk diffusion assays

    • Growth curve analysis in subinhibitory H₂O₂ concentrations

    • ROS accumulation measurements (DCF-DA fluorescence)

  • Determine whether GET1 dysfunction affects localization of oxidative stress response proteins

  • Investigate GET1 expression patterns in clinical isolates exposed to host-derived oxidative stress

This research would be particularly relevant given the trade-offs observed between antifungal resistance and oxidative stress resistance in C. lusitaniae isolates from chronic infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.