Recombinant Clavispora lusitaniae Golgi to ER traffic protein 2 (GET2)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GET2; CLUG_05762; Golgi to ER traffic protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Clavispora lusitaniae (strain ATCC 42720) (Yeast) (Candida lusitaniae)
Target Names
GET2
Target Protein Sequence
MSELSAEEKRKLLRERRQAKMAQGKATDRLNNILSQGSSVKSSNVTSVLDKPEKATTTVM
DLPSRETQSPTPLHDDPEVPDITSLLKEKENEAPDMEAMLQQILGGSGAHTGPGNDGGAN
FLQEMMKAMAEDPSGGSTAEESSYQSQLSQYHAYEQKQWKARFLVVRWIIHTLNFVYHYI
ASGYKLSASPYAFVRAQAVDSHVRTFFTAFLTVEVAVISAYFLVMSQPKFKDFSRENLVS
RILSMASAVVPAVGRYQPLVTRALVYWNGASIFVGDLMLMVFYFGITSVLGN
Uniprot No.
Target Background
Function
Function: Recombinant Clavispora lusitaniae Golgi to ER traffic protein 2 (GET2) is essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). In conjunction with GET1, it functions as a membrane receptor for soluble GET3. GET3 specifically recognizes and binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of ER resident proteins, possessing a C-terminal H-D-E-L retention signal, from the Golgi apparatus back to the ER.
Database Links
KEGG: clu:CLUG_05762
STRING: 306902.XP_002614276.1
Protein Families
GET2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
