Recombinant Clavispora lusitaniae Probable endonuclease LCL3 (LCL3) is a protein derived from the yeast species Clavispora lusitaniae, also known as Candida lusitaniae . LCL3 is identified as a probable endonuclease, which suggests it functions as an enzyme that facilitates the cleavage of phosphodiester bonds in nucleic acids . The recombinant form indicates that the protein is produced using genetic engineering techniques, where the gene encoding LCL3 is inserted into a host organism to produce the protein in large quantities .
Tag Information: The specific tag type is determined during the production process .
Storage Buffer: Tris-based buffer with 50% glycerol, optimized for the protein .
Storage Conditions: Store at -20℃; for extended storage, conserve at -20℃ or -80℃. Repeated freezing and thawing are not recommended. Working aliquots can be stored at 4℃ for up to one week .
Amino Acid Sequence: The provided sequence is: MSDEPLSSSEESPSVSVLHPKVLLLSAGFTGAAAASYFLYGRYVRRVKTYLDLTPAILDGQRKLYGKVTRVGDGDNFRFFHTPGGVLLGWGWLRKIPDTRSGLKDQTLMVRLCGVDAPER SHFGKPAQPFSEEALQWLQSYVGGRSVTITPYSIDQYKRVVARAQVWRWTGKRDVSAEmLRNGLGVVYEANSGAEFGENEGWYRRLEEKAKRRRRGMWSLGSKLVTPGNFKRQ .
As a probable endonuclease, LCL3 likely participates in DNA or RNA processing, repair, or degradation within Clavispora lusitaniae . Endonucleases are crucial in various cellular processes, including DNA replication, recombination, and defense against foreign nucleic acids. Further research would be needed to elucidate the specific function and substrates of LCL3 in Clavispora lusitaniae.
Clavispora lusitaniae is an emerging non-albicans Candida species known for causing invasive infections, particularly in immunocompromised individuals . It has the capacity to rapidly develop resistance to antifungal drugs, making it a clinically significant concern .
C. lusitaniae exhibits several mechanisms of drug resistance, including mutations in genes such as ERG3, FKS1, and MRR1 .
ERG3 and ERG4 Mutations: Mutations in ERG3 and ERG4 can lead to resistance to amphotericin B (AmB) . Specifically, ERG3 missense mutations have been associated with cross-resistance to both micafungin and fluconazole .
MRR1 Involvement: The MRR1 gene plays a role in fluconazole (FLC) resistance. Upregulation of MRR1 and genes it regulates, such as MFS7 and CDR1, contributes to azole resistance .
FKS1 Mutations: Different FKS1 alleles have been identified among isolates with decreased micafungin susceptibility .
C. lusitaniae exhibits virulence factors that contribute to its pathogenicity . These include:
Hydrophobicity: C. lusitaniae has higher cell wall hydrophobicity compared to C. albicans .
Biofilm Formation: Ability to form biofilms, which enhances its resistance to antifungals and host immune responses .
Adherence: Capacity to adhere to host tissues, facilitating colonization and infection .
Enzyme Activity: Lipase activity, which aids in nutrient acquisition and tissue invasion .
Osmotic Stress Resistance: Resistance to osmotic stress, allowing it to survive in diverse host environments .
Invasive Infections: C. lusitaniae can cause life-threatening invasive infections, such as empyema thoracis .
Rapid Drug Resistance: The species can rapidly develop multidrug resistance during antifungal therapy, complicating treatment strategies .
KEGG: clu:CLUG_03208
STRING: 306902.XP_002615967.1
Clavispora lusitaniae (formerly Candida lusitaniae) is an opportunistic fungal pathogen that serves as an important model organism for studying fungal evolution, drug resistance mechanisms, and host-pathogen interactions in chronic infections. C. lusitaniae has gained significant research attention due to its capacity for rapid evolutionary adaptation during chronic infections, making it valuable for studying proteins like endonuclease LCL3 .
The organism demonstrates remarkable genetic adaptability, as evidenced by studies showing parallel evolution of multiple alleles within single infections. This evolutionary plasticity makes it particularly useful for studying the regulation and function of DNA-modifying enzymes like endonucleases, which may play roles in genomic stability and stress responses.
LCL3 belongs to a family of probable endonucleases in Clavispora lusitaniae that function in DNA processing. While specific information about LCL3 is limited in the available literature, fungal endonucleases generally serve critical functions in DNA repair, recombination, and stress responses.
Unlike better-characterized endonucleases in related species like Candida albicans, our understanding of C. lusitaniae endonucleases is still developing. Research approaches that have been successful with transcription factors like Mrr1, which has been extensively studied in C. lusitaniae, could be applied to LCL3 research . Similar to how researchers have characterized the functional domains of Mrr1 through mutation analysis, the functional regions of LCL3 could be identified through systematic mutagenesis and activity assays.
For recombinant expression of C. lusitaniae proteins like LCL3, researchers should consider several expression systems based on experimental goals:
Homologous Expression: Using C. lusitaniae itself as an expression host offers the advantage of proper post-translational modifications and native-like folding.
Heterologous Expression: Common systems include:
E. coli: Suitable for structural studies and biochemical characterization
S. cerevisiae: Better for proteins requiring eukaryotic processing
P. pastoris: Preferred for higher yields of secreted eukaryotic proteins
Each system presents different advantages for studying endonucleases, with methodological considerations similar to those used for expressing other C. lusitaniae proteins. When expressing endonucleases, researchers often need to balance between protein yield and avoiding toxicity from non-specific DNA cleavage in the host organism.
When designing experiments to assess LCL3 endonuclease activity, researchers should optimize several parameters:
Buffer composition:
Buffer type: Typically Tris-HCl (pH 7.5-8.5) or HEPES (pH 7.0-8.0)
Divalent cations: Test various concentrations of Mg²⁺, Mn²⁺, Ca²⁺, and Zn²⁺ (0.5-10 mM)
Monovalent salts: NaCl or KCl (50-150 mM)
Reducing agents: DTT or β-mercaptoethanol (0.5-5 mM)
Reaction conditions:
Temperature: Test range between 25-37°C
Incubation time: Typically 15-60 minutes, with time-course monitoring
Enzyme:substrate ratio: Start with 1:10 to 1:100 molar ratio
Substrate considerations:
Use various DNA structures (linear, circular, single-stranded, double-stranded)
Include control substrates with known cleavage patterns from related endonucleases
Similar methodological approaches have been used successfully in studies of other fungal proteins, where careful optimization of reaction conditions revealed distinct activity profiles under different environmental stressors .
Based on successful approaches used for studying C. lusitaniae genes like MRR1, a methodical approach to study LCL3 function through gene deletion would include:
Construct design:
Create deletion cassettes containing a selectable marker (e.g., nourseothricin resistance) flanked by 500-1000 bp homology regions upstream and downstream of LCL3
Include unique restriction sites for verification
Consider designing reintegration constructs simultaneously
Transformation protocol:
Prepare competent cells using lithium acetate/PEG method optimized for C. lusitaniae
Transform with 5-10 μg of linearized deletion construct
Plate on selective media containing appropriate antibiotic
Verification strategies:
PCR confirmation using primers outside the integration region
Southern blot analysis to confirm single integration
RT-PCR to verify absence of transcript
Complementation testing:
Reintroduce wild-type LCL3 at the native locus or at a neutral integration site
Include controls with known mutations to validate phenotype rescue
This approach mirrors the successful methodologies used by researchers studying the MRR1 gene in C. lusitaniae, where deletion and complementation were essential for determining gene function .
If standard deletion approaches fail due to LCL3 being essential, consider these alternative strategies:
Conditional expression systems:
Tetracycline-repressible promoter systems
Methionine-regulated promoters (MET3)
Estrogen-responsive elements
Domain disruption:
Target specific functional domains rather than the entire gene
Create point mutations in catalytic residues
Introduce premature stop codons at various positions to generate truncated proteins
RNAi or CRISPR interference:
Establish knockdown systems if complete knockout is lethal
Use CRISPRi with catalytically inactive Cas9 to repress transcription
Degron tagging:
Fuse auxin-inducible or temperature-sensitive degron tags
Allow controlled degradation of the protein under specific conditions
These approaches have been successfully employed in studies of other C. lusitaniae proteins. For example, researchers studying Mrr1 revealed that C-terminal truncations at different positions had varying effects on protein function, with some mutations before amino acid position 1116 causing complete loss of activity .
Based on patterns observed with other C. lusitaniae proteins, LCL3 expression and activity likely respond to specific environmental stressors. To investigate this systematically:
Stress conditions to test:
Oxidative stress (H₂O₂, menadione, diamide)
Antifungal exposure (fluconazole, amphotericin B)
pH stress (acidic/alkaline conditions)
Nutrient limitation
Host immune factors (neutrophil exposure, antimicrobial peptides)
Measurement approaches:
qRT-PCR to quantify transcript levels
Western blotting with tagged LCL3 constructs
Reporter gene assays (e.g., LCL3 promoter fused to GFP)
Chromatin immunoprecipitation to identify regulators
Activity correlation:
Develop assays to measure endonuclease activity under different conditions
Correlate activity with expression levels and post-translational modifications
Research on C. lusitaniae has revealed complex stress response patterns. For example, strains with high Mrr1 activity showed increased resistance to fluconazole but greater sensitivity to hydrogen peroxide, suggesting important tradeoffs in stress response mechanisms . Similar tradeoffs might exist with LCL3 function under different environmental conditions.
While specific structural information about LCL3 is limited, a domain analysis approach similar to that used for other C. lusitaniae proteins would include:
Computational prediction:
Sequence alignment with characterized endonucleases
Secondary structure prediction
Domain identification using tools like SMART, Pfam, and InterPro
Homology modeling based on related structures
Experimental validation:
Create systematic truncations to identify minimal functional units
Generate point mutations in predicted catalytic residues
Perform limited proteolysis to identify stable domains
Express isolated domains to test for independent function
Domain-function correlations:
DNA binding domains
Catalytic domains
Regulatory regions
Potential protein-protein interaction interfaces
Studies of Mrr1 in C. lusitaniae have demonstrated how critical the C-terminal region is for constitutive activity while being dispensable for induction by environmental stressors like benomyl . Similar structural-functional relationships could be investigated for LCL3.
Given the role of endonucleases in DNA processing and the observed genomic plasticity of C. lusitaniae during chronic infections, LCL3 may play important roles in adaptation:
Potential mechanisms:
Facilitation of homologous recombination
Resolution of DNA damage during stress
Processing of stalled replication forks
Generation of genetic diversity through error-prone repair
Experimental approaches:
Compare mutation rates and spectra between wild-type and LCL3-deficient strains
Analyze adaptation rates to various stressors
Track genomic changes during laboratory evolution experiments
Examine LCL3 localization during stress using fluorescent tagging
Clinical relevance:
Study LCL3 sequence and expression in clinical isolates
Correlate LCL3 variants with adaptation to host environments
Investigate potential roles in antifungal resistance development
Research on C. lusitaniae populations from chronic infections has revealed remarkable genomic plasticity, with parallel evolution of multiple alleles of genes like MRR1 . Endonucleases like LCL3 might facilitate the genomic rearrangements and mutations that enable such rapid adaptation.
Researchers working with recombinant endonucleases like LCL3 often encounter several challenges:
Expression issues:
Challenge: Low expression or insolubility
Solutions:
Test multiple expression vectors with different promoter strengths
Optimize codon usage for the expression host
Try fusion tags (MBP, SUMO, GST) to enhance solubility
Test expression at lower temperatures (16-20°C)
Purification challenges:
Challenge: Co-purification with nucleic acids
Solutions:
Include high salt (0.5-1M NaCl) in purification buffers
Add nucleases (Benzonase or DNase I) during lysis
Use ion exchange chromatography steps
Consider on-column refolding protocols
Activity retention:
Challenge: Loss of activity during purification
Solutions:
Include stabilizing agents (glycerol 10-20%, reducing agents)
Minimize freeze-thaw cycles
Test activity immediately after purification
Optimize buffer composition for storage
Troubleshooting inconsistent activity:
Perform metal ion reconstitution experiments
Test activity with multiple substrate types
Verify protein folding using circular dichroism
Assess oligomerization state using size exclusion chromatography
These approaches are similar to those used for studying other C. lusitaniae proteins where careful optimization of conditions was necessary to maintain function after purification .
When working with LCL3 variants that display contradictory phenotypes, consider these analytical approaches:
Systematic phenotypic characterization:
Create a comprehensive phenotypic profile under multiple conditions
Quantify tradeoffs between different phenotypes
Use principal component analysis to identify patterns
Correlation with structural features:
Map mutations to predicted structural domains
Look for patterns in mutations affecting the same domain
Consider epistatic interactions between multiple mutations
Evolutionary context:
Compare with natural variation in clinical isolates
Consider whether contradictory phenotypes reflect adaptation to different niches
Analyze temporal dynamics in evolving populations
Mechanistic resolution:
Measure biochemical parameters (Km, kcat, substrate specificity)
Examine protein-protein interactions
Assess post-translational modifications
Studies of C. lusitaniae MRR1 revealed apparent contradictions where some mutations increased fluconazole resistance but decreased hydrogen peroxide resistance, suggesting important functional tradeoffs . Similar complex phenotypic patterns might emerge with LCL3 variants.
To investigate protein-protein interactions involving LCL3:
Co-immunoprecipitation approaches:
Tag LCL3 with epitope tags (HA, FLAG, Myc)
Perform pull-downs under various conditions
Identify interacting partners using mass spectrometry
Validate interactions with reciprocal pull-downs
Proximity labeling methods:
BioID or TurboID fusion to LCL3
APEX2-based proximity labeling
Analyze biotinylated proteins from different cellular compartments
Genetic interaction screens:
Synthetic genetic array analysis
Genetic suppressor screens
Dosage-dependent interaction studies
Visualization techniques:
Bimolecular fluorescence complementation
Förster resonance energy transfer (FRET)
Co-localization studies using confocal microscopy
In vitro validation:
Express and purify candidate interacting partners
Perform direct binding assays
Study functional consequences of interactions
Researchers studying C. lusitaniae have successfully used genetic approaches to identify functional relationships between genes involved in stress responses . Similar approaches could reveal the protein interaction network involving LCL3.
Endonucleases can serve as valuable tools for genome editing. Potential applications for LCL3 include:
Targeted genome editing:
Characterize LCL3 sequence specificity
Engineer variants with altered specificity
Combine with programmable DNA-binding domains
Develop LCL3-based gene editing systems specific to Clavispora
Methodological approach:
Define cleavage preferences using in vitro selection
Create fusion proteins with programmable DNA-binding modules
Test editing efficiency in C. lusitaniae and related species
Compare with existing CRISPR-Cas systems
Potential advantages:
Species-specific editing tools
Potentially smaller size compared to Cas9
Unique catalytic properties
Lower immunogenicity for therapeutic applications
The development of such tools would parallel approaches used for other fungal genetic manipulation systems, providing researchers with expanded options for studying C. lusitaniae biology .
Based on research showing complex evolutionary dynamics in C. lusitaniae during chronic infections, LCL3 might contribute to adaptation through:
Potential adaptive mechanisms:
Facilitation of DNA repair under host-induced stress
Generation of genetic diversity through specific DNA processing
Regulation of mobile genetic elements
Processing of recombination intermediates
Experimental investigation:
Compare LCL3 sequences and expression in sequential clinical isolates
Analyze phenotypes of LCL3 variants in chronic infection models
Test adaptation rates with wild-type versus modified LCL3
Examine population heterogeneity in LCL3 alleles during infection
Clinical implications:
Potential role in development of antifungal resistance
Contribution to persistence during antimicrobial therapy
Impact on host-pathogen interactions
Studies of C. lusitaniae populations from chronic infections have shown remarkable genetic diversity developing over time, with shifts between phenotypes that confer resistance to different stressors . Endonucleases like LCL3 might be key facilitators of this adaptive capacity.
Systems-level approaches can provide comprehensive insights into LCL3 function:
Multi-omics integration:
Transcriptomic analysis under various conditions
Proteomics to identify post-translational modifications
Metabolomics to detect downstream metabolic effects
Genomics to identify natural variants and their phenotypic effects
Network analysis:
Construct protein-protein interaction networks
Identify genetic interaction networks through synthetic genetic arrays
Map regulatory networks controlling LCL3 expression
Model the impact of LCL3 activity on cellular processes
Computational predictions:
Simulate LCL3 activity under different conditions
Model evolutionary trajectories of LCL3 variants
Predict phenotypic consequences of LCL3 modifications
Experimental validation:
Test key predictions using targeted experiments
Develop reporter systems for monitoring LCL3 activity in real-time
Create synthetic genetic circuits to probe LCL3 function