Recombinant Clavispora lusitaniae Probable endonuclease LCL3 (LCL3)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Clavispora lusitaniae Probable endonuclease LCL3 (LCL3) is a protein derived from the yeast species Clavispora lusitaniae, also known as Candida lusitaniae . LCL3 is identified as a probable endonuclease, which suggests it functions as an enzyme that facilitates the cleavage of phosphodiester bonds in nucleic acids . The recombinant form indicates that the protein is produced using genetic engineering techniques, where the gene encoding LCL3 is inserted into a host organism to produce the protein in large quantities .

Protein Properties and Characteristics

  • Source Organism: Clavispora lusitaniae (strain ATCC 42720)

  • UniProt Accession Number: C4Y4X4

  • Tag Information: The specific tag type is determined during the production process .

  • Storage Buffer: Tris-based buffer with 50% glycerol, optimized for the protein .

  • Storage Conditions: Store at -20℃; for extended storage, conserve at -20℃ or -80℃. Repeated freezing and thawing are not recommended. Working aliquots can be stored at 4℃ for up to one week .

  • Amino Acid Sequence: The provided sequence is: MSDEPLSSSEESPSVSVLHPKVLLLSAGFTGAAAASYFLYGRYVRRVKTYLDLTPAILDGQRKLYGKVTRVGDGDNFRFFHTPGGVLLGWGWLRKIPDTRSGLKDQTLMVRLCGVDAPER SHFGKPAQPFSEEALQWLQSYVGGRSVTITPYSIDQYKRVVARAQVWRWTGKRDVSAEmLRNGLGVVYEANSGAEFGENEGWYRRLEEKAKRRRRGMWSLGSKLVTPGNFKRQ .

  • Protein Names: Probable endonuclease LCL3

  • EC Number: 3.1.-.-

  • Gene Names: LCL3

  • ORF Names: CLUG_03208

  • Expression Region: Amino acids 1-233

  • Sequence Length: Full length protein

Potential Functions and Role

As a probable endonuclease, LCL3 likely participates in DNA or RNA processing, repair, or degradation within Clavispora lusitaniae . Endonucleases are crucial in various cellular processes, including DNA replication, recombination, and defense against foreign nucleic acids. Further research would be needed to elucidate the specific function and substrates of LCL3 in Clavispora lusitaniae.

Clavispora lusitaniae as an Opportunistic Pathogen

Clavispora lusitaniae is an emerging non-albicans Candida species known for causing invasive infections, particularly in immunocompromised individuals . It has the capacity to rapidly develop resistance to antifungal drugs, making it a clinically significant concern .

Resistance Mechanisms in C. lusitaniae

C. lusitaniae exhibits several mechanisms of drug resistance, including mutations in genes such as ERG3, FKS1, and MRR1 .

  • ERG3 and ERG4 Mutations: Mutations in ERG3 and ERG4 can lead to resistance to amphotericin B (AmB) . Specifically, ERG3 missense mutations have been associated with cross-resistance to both micafungin and fluconazole .

  • MRR1 Involvement: The MRR1 gene plays a role in fluconazole (FLC) resistance. Upregulation of MRR1 and genes it regulates, such as MFS7 and CDR1, contributes to azole resistance .

  • FKS1 Mutations: Different FKS1 alleles have been identified among isolates with decreased micafungin susceptibility .

Virulence Factors

C. lusitaniae exhibits virulence factors that contribute to its pathogenicity . These include:

  • Hydrophobicity: C. lusitaniae has higher cell wall hydrophobicity compared to C. albicans .

  • Biofilm Formation: Ability to form biofilms, which enhances its resistance to antifungals and host immune responses .

  • Adherence: Capacity to adhere to host tissues, facilitating colonization and infection .

  • Enzyme Activity: Lipase activity, which aids in nutrient acquisition and tissue invasion .

  • Osmotic Stress Resistance: Resistance to osmotic stress, allowing it to survive in diverse host environments .

Clinical Significance

  • Invasive Infections: C. lusitaniae can cause life-threatening invasive infections, such as empyema thoracis .

  • Rapid Drug Resistance: The species can rapidly develop multidrug resistance during antifungal therapy, complicating treatment strategies .

Tables

GeneRoleResistance Mechanism
ERG3Ergosterol biosynthesisLoss-of-function mutations leading to AmB resistance; cross-resistance to both micafungin and fluconazole
ERG4Ergosterol biosynthesisLoss-of-function mutations leading to AmB resistance
MRR1Transcriptional regulatorUpregulation leads to increased expression of drug efflux pumps, increasing azole resistance
FKS1Subunit of 1,3-β-D-glucan synthaseMutations associated with decreased micafungin susceptibility
Virulence FactorDescriptionSignificance
HydrophobicityHigher cell wall hydrophobicity compared to C. albicansEnhances adhesion and biofilm formation
Biofilm FormationAbility to form biofilmsIncreases resistance to antifungals and host immune responses
AdherenceCapacity to adhere to host tissuesFacilitates colonization and infection
Lipase ActivityProduction of lipase enzymesAids in nutrient acquisition and tissue invasion
Osmotic ResistanceAbility to withstand osmotic stressEnables survival in diverse host environments

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request and incurs additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life is 6 months at -20°C/-80°C for liquid formulations and 12 months at -20°C/-80°C for lyophilized formulations.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
LCL3; CLUG_03208; Probable endonuclease LCL3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Clavispora lusitaniae (strain ATCC 42720) (Yeast) (Candida lusitaniae)
Target Names
LCL3
Target Protein Sequence
MSDEPLSSSEESPSVSVLHPKVLLLSAGFTGAAAASYFLYGRYVRRVKTYLDLTPAILDG QRKLYGKVTRVGDGDNFRFFHTPGGVLLGWGWLRKIPDTRSGLKDQTLMVRLCGVDAPER SHFGKPAQPFSEEALQWLQSYVGGRSVTITPYSIDQYKRVVARAQVWRWTGKRDVSAEML RNGLGVVYEANSGAEFGENEGWYRRLEEKAKRRRRGMWSLGSKLVTPGNFKRQ
Uniprot No.

Target Background

Database Links
Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What is Clavispora lusitaniae and why is it relevant to LCL3 research?

Clavispora lusitaniae (formerly Candida lusitaniae) is an opportunistic fungal pathogen that serves as an important model organism for studying fungal evolution, drug resistance mechanisms, and host-pathogen interactions in chronic infections. C. lusitaniae has gained significant research attention due to its capacity for rapid evolutionary adaptation during chronic infections, making it valuable for studying proteins like endonuclease LCL3 .

The organism demonstrates remarkable genetic adaptability, as evidenced by studies showing parallel evolution of multiple alleles within single infections. This evolutionary plasticity makes it particularly useful for studying the regulation and function of DNA-modifying enzymes like endonucleases, which may play roles in genomic stability and stress responses.

How does LCL3 compare to other endonucleases in fungal systems?

LCL3 belongs to a family of probable endonucleases in Clavispora lusitaniae that function in DNA processing. While specific information about LCL3 is limited in the available literature, fungal endonucleases generally serve critical functions in DNA repair, recombination, and stress responses.

Unlike better-characterized endonucleases in related species like Candida albicans, our understanding of C. lusitaniae endonucleases is still developing. Research approaches that have been successful with transcription factors like Mrr1, which has been extensively studied in C. lusitaniae, could be applied to LCL3 research . Similar to how researchers have characterized the functional domains of Mrr1 through mutation analysis, the functional regions of LCL3 could be identified through systematic mutagenesis and activity assays.

What expression systems are recommended for producing recombinant C. lusitaniae proteins?

For recombinant expression of C. lusitaniae proteins like LCL3, researchers should consider several expression systems based on experimental goals:

  • Homologous Expression: Using C. lusitaniae itself as an expression host offers the advantage of proper post-translational modifications and native-like folding.

  • Heterologous Expression: Common systems include:

    • E. coli: Suitable for structural studies and biochemical characterization

    • S. cerevisiae: Better for proteins requiring eukaryotic processing

    • P. pastoris: Preferred for higher yields of secreted eukaryotic proteins

Each system presents different advantages for studying endonucleases, with methodological considerations similar to those used for expressing other C. lusitaniae proteins. When expressing endonucleases, researchers often need to balance between protein yield and avoiding toxicity from non-specific DNA cleavage in the host organism.

What are the optimal conditions for assessing LCL3 endonuclease activity in vitro?

When designing experiments to assess LCL3 endonuclease activity, researchers should optimize several parameters:

Buffer composition:

  • Buffer type: Typically Tris-HCl (pH 7.5-8.5) or HEPES (pH 7.0-8.0)

  • Divalent cations: Test various concentrations of Mg²⁺, Mn²⁺, Ca²⁺, and Zn²⁺ (0.5-10 mM)

  • Monovalent salts: NaCl or KCl (50-150 mM)

  • Reducing agents: DTT or β-mercaptoethanol (0.5-5 mM)

Reaction conditions:

  • Temperature: Test range between 25-37°C

  • Incubation time: Typically 15-60 minutes, with time-course monitoring

  • Enzyme:substrate ratio: Start with 1:10 to 1:100 molar ratio

Substrate considerations:

  • Use various DNA structures (linear, circular, single-stranded, double-stranded)

  • Include control substrates with known cleavage patterns from related endonucleases

Similar methodological approaches have been used successfully in studies of other fungal proteins, where careful optimization of reaction conditions revealed distinct activity profiles under different environmental stressors .

How can I design gene deletion experiments to study LCL3 function in C. lusitaniae?

Based on successful approaches used for studying C. lusitaniae genes like MRR1, a methodical approach to study LCL3 function through gene deletion would include:

  • Construct design:

    • Create deletion cassettes containing a selectable marker (e.g., nourseothricin resistance) flanked by 500-1000 bp homology regions upstream and downstream of LCL3

    • Include unique restriction sites for verification

    • Consider designing reintegration constructs simultaneously

  • Transformation protocol:

    • Prepare competent cells using lithium acetate/PEG method optimized for C. lusitaniae

    • Transform with 5-10 μg of linearized deletion construct

    • Plate on selective media containing appropriate antibiotic

  • Verification strategies:

    • PCR confirmation using primers outside the integration region

    • Southern blot analysis to confirm single integration

    • RT-PCR to verify absence of transcript

  • Complementation testing:

    • Reintroduce wild-type LCL3 at the native locus or at a neutral integration site

    • Include controls with known mutations to validate phenotype rescue

This approach mirrors the successful methodologies used by researchers studying the MRR1 gene in C. lusitaniae, where deletion and complementation were essential for determining gene function .

What approaches can help resolve the challenges of working with potentially essential genes like LCL3?

If standard deletion approaches fail due to LCL3 being essential, consider these alternative strategies:

  • Conditional expression systems:

    • Tetracycline-repressible promoter systems

    • Methionine-regulated promoters (MET3)

    • Estrogen-responsive elements

  • Domain disruption:

    • Target specific functional domains rather than the entire gene

    • Create point mutations in catalytic residues

    • Introduce premature stop codons at various positions to generate truncated proteins

  • RNAi or CRISPR interference:

    • Establish knockdown systems if complete knockout is lethal

    • Use CRISPRi with catalytically inactive Cas9 to repress transcription

  • Degron tagging:

    • Fuse auxin-inducible or temperature-sensitive degron tags

    • Allow controlled degradation of the protein under specific conditions

These approaches have been successfully employed in studies of other C. lusitaniae proteins. For example, researchers studying Mrr1 revealed that C-terminal truncations at different positions had varying effects on protein function, with some mutations before amino acid position 1116 causing complete loss of activity .

How do environmental stressors affect LCL3 expression and activity in C. lusitaniae?

Based on patterns observed with other C. lusitaniae proteins, LCL3 expression and activity likely respond to specific environmental stressors. To investigate this systematically:

  • Stress conditions to test:

    • Oxidative stress (H₂O₂, menadione, diamide)

    • Antifungal exposure (fluconazole, amphotericin B)

    • pH stress (acidic/alkaline conditions)

    • Nutrient limitation

    • Host immune factors (neutrophil exposure, antimicrobial peptides)

  • Measurement approaches:

    • qRT-PCR to quantify transcript levels

    • Western blotting with tagged LCL3 constructs

    • Reporter gene assays (e.g., LCL3 promoter fused to GFP)

    • Chromatin immunoprecipitation to identify regulators

  • Activity correlation:

    • Develop assays to measure endonuclease activity under different conditions

    • Correlate activity with expression levels and post-translational modifications

Research on C. lusitaniae has revealed complex stress response patterns. For example, strains with high Mrr1 activity showed increased resistance to fluconazole but greater sensitivity to hydrogen peroxide, suggesting important tradeoffs in stress response mechanisms . Similar tradeoffs might exist with LCL3 function under different environmental conditions.

What is known about the structural domains of LCL3 and how do they contribute to function?

While specific structural information about LCL3 is limited, a domain analysis approach similar to that used for other C. lusitaniae proteins would include:

  • Computational prediction:

    • Sequence alignment with characterized endonucleases

    • Secondary structure prediction

    • Domain identification using tools like SMART, Pfam, and InterPro

    • Homology modeling based on related structures

  • Experimental validation:

    • Create systematic truncations to identify minimal functional units

    • Generate point mutations in predicted catalytic residues

    • Perform limited proteolysis to identify stable domains

    • Express isolated domains to test for independent function

  • Domain-function correlations:

    • DNA binding domains

    • Catalytic domains

    • Regulatory regions

    • Potential protein-protein interaction interfaces

Studies of Mrr1 in C. lusitaniae have demonstrated how critical the C-terminal region is for constitutive activity while being dispensable for induction by environmental stressors like benomyl . Similar structural-functional relationships could be investigated for LCL3.

How does LCL3 potentially contribute to genomic plasticity and adaptation during chronic infections?

Given the role of endonucleases in DNA processing and the observed genomic plasticity of C. lusitaniae during chronic infections, LCL3 may play important roles in adaptation:

  • Potential mechanisms:

    • Facilitation of homologous recombination

    • Resolution of DNA damage during stress

    • Processing of stalled replication forks

    • Generation of genetic diversity through error-prone repair

  • Experimental approaches:

    • Compare mutation rates and spectra between wild-type and LCL3-deficient strains

    • Analyze adaptation rates to various stressors

    • Track genomic changes during laboratory evolution experiments

    • Examine LCL3 localization during stress using fluorescent tagging

  • Clinical relevance:

    • Study LCL3 sequence and expression in clinical isolates

    • Correlate LCL3 variants with adaptation to host environments

    • Investigate potential roles in antifungal resistance development

Research on C. lusitaniae populations from chronic infections has revealed remarkable genomic plasticity, with parallel evolution of multiple alleles of genes like MRR1 . Endonucleases like LCL3 might facilitate the genomic rearrangements and mutations that enable such rapid adaptation.

What are the common challenges in purifying active recombinant LCL3 and how can they be addressed?

Researchers working with recombinant endonucleases like LCL3 often encounter several challenges:

  • Expression issues:

    • Challenge: Low expression or insolubility

    • Solutions:

      • Test multiple expression vectors with different promoter strengths

      • Optimize codon usage for the expression host

      • Try fusion tags (MBP, SUMO, GST) to enhance solubility

      • Test expression at lower temperatures (16-20°C)

  • Purification challenges:

    • Challenge: Co-purification with nucleic acids

    • Solutions:

      • Include high salt (0.5-1M NaCl) in purification buffers

      • Add nucleases (Benzonase or DNase I) during lysis

      • Use ion exchange chromatography steps

      • Consider on-column refolding protocols

  • Activity retention:

    • Challenge: Loss of activity during purification

    • Solutions:

      • Include stabilizing agents (glycerol 10-20%, reducing agents)

      • Minimize freeze-thaw cycles

      • Test activity immediately after purification

      • Optimize buffer composition for storage

  • Troubleshooting inconsistent activity:

    • Perform metal ion reconstitution experiments

    • Test activity with multiple substrate types

    • Verify protein folding using circular dichroism

    • Assess oligomerization state using size exclusion chromatography

These approaches are similar to those used for studying other C. lusitaniae proteins where careful optimization of conditions was necessary to maintain function after purification .

How can I analyze and interpret contradictory phenotypes in LCL3 variant studies?

When working with LCL3 variants that display contradictory phenotypes, consider these analytical approaches:

  • Systematic phenotypic characterization:

    • Create a comprehensive phenotypic profile under multiple conditions

    • Quantify tradeoffs between different phenotypes

    • Use principal component analysis to identify patterns

  • Correlation with structural features:

    • Map mutations to predicted structural domains

    • Look for patterns in mutations affecting the same domain

    • Consider epistatic interactions between multiple mutations

  • Evolutionary context:

    • Compare with natural variation in clinical isolates

    • Consider whether contradictory phenotypes reflect adaptation to different niches

    • Analyze temporal dynamics in evolving populations

  • Mechanistic resolution:

    • Measure biochemical parameters (Km, kcat, substrate specificity)

    • Examine protein-protein interactions

    • Assess post-translational modifications

Studies of C. lusitaniae MRR1 revealed apparent contradictions where some mutations increased fluconazole resistance but decreased hydrogen peroxide resistance, suggesting important functional tradeoffs . Similar complex phenotypic patterns might emerge with LCL3 variants.

What are the best approaches for studying potential interactions between LCL3 and other proteins in C. lusitaniae?

To investigate protein-protein interactions involving LCL3:

  • Co-immunoprecipitation approaches:

    • Tag LCL3 with epitope tags (HA, FLAG, Myc)

    • Perform pull-downs under various conditions

    • Identify interacting partners using mass spectrometry

    • Validate interactions with reciprocal pull-downs

  • Proximity labeling methods:

    • BioID or TurboID fusion to LCL3

    • APEX2-based proximity labeling

    • Analyze biotinylated proteins from different cellular compartments

  • Genetic interaction screens:

    • Synthetic genetic array analysis

    • Genetic suppressor screens

    • Dosage-dependent interaction studies

  • Visualization techniques:

    • Bimolecular fluorescence complementation

    • Förster resonance energy transfer (FRET)

    • Co-localization studies using confocal microscopy

  • In vitro validation:

    • Express and purify candidate interacting partners

    • Perform direct binding assays

    • Study functional consequences of interactions

Researchers studying C. lusitaniae have successfully used genetic approaches to identify functional relationships between genes involved in stress responses . Similar approaches could reveal the protein interaction network involving LCL3.

How might LCL3 be employed in genome editing applications for C. lusitaniae?

Endonucleases can serve as valuable tools for genome editing. Potential applications for LCL3 include:

  • Targeted genome editing:

    • Characterize LCL3 sequence specificity

    • Engineer variants with altered specificity

    • Combine with programmable DNA-binding domains

    • Develop LCL3-based gene editing systems specific to Clavispora

  • Methodological approach:

    • Define cleavage preferences using in vitro selection

    • Create fusion proteins with programmable DNA-binding modules

    • Test editing efficiency in C. lusitaniae and related species

    • Compare with existing CRISPR-Cas systems

  • Potential advantages:

    • Species-specific editing tools

    • Potentially smaller size compared to Cas9

    • Unique catalytic properties

    • Lower immunogenicity for therapeutic applications

The development of such tools would parallel approaches used for other fungal genetic manipulation systems, providing researchers with expanded options for studying C. lusitaniae biology .

What role might LCL3 play in the adaptation of C. lusitaniae to chronic infection environments?

Based on research showing complex evolutionary dynamics in C. lusitaniae during chronic infections, LCL3 might contribute to adaptation through:

  • Potential adaptive mechanisms:

    • Facilitation of DNA repair under host-induced stress

    • Generation of genetic diversity through specific DNA processing

    • Regulation of mobile genetic elements

    • Processing of recombination intermediates

  • Experimental investigation:

    • Compare LCL3 sequences and expression in sequential clinical isolates

    • Analyze phenotypes of LCL3 variants in chronic infection models

    • Test adaptation rates with wild-type versus modified LCL3

    • Examine population heterogeneity in LCL3 alleles during infection

  • Clinical implications:

    • Potential role in development of antifungal resistance

    • Contribution to persistence during antimicrobial therapy

    • Impact on host-pathogen interactions

Studies of C. lusitaniae populations from chronic infections have shown remarkable genetic diversity developing over time, with shifts between phenotypes that confer resistance to different stressors . Endonucleases like LCL3 might be key facilitators of this adaptive capacity.

How can systems biology approaches advance our understanding of LCL3 function in the context of fungal stress responses?

Systems-level approaches can provide comprehensive insights into LCL3 function:

  • Multi-omics integration:

    • Transcriptomic analysis under various conditions

    • Proteomics to identify post-translational modifications

    • Metabolomics to detect downstream metabolic effects

    • Genomics to identify natural variants and their phenotypic effects

  • Network analysis:

    • Construct protein-protein interaction networks

    • Identify genetic interaction networks through synthetic genetic arrays

    • Map regulatory networks controlling LCL3 expression

    • Model the impact of LCL3 activity on cellular processes

  • Computational predictions:

    • Simulate LCL3 activity under different conditions

    • Model evolutionary trajectories of LCL3 variants

    • Predict phenotypic consequences of LCL3 modifications

  • Experimental validation:

    • Test key predictions using targeted experiments

    • Develop reporter systems for monitoring LCL3 activity in real-time

    • Create synthetic genetic circuits to probe LCL3 function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.