Recombinant Clostridium acetobutylicum Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Clostridium acetobutylicum Cobalamin Synthase (cobS) is a genetically engineered enzyme involved in the biosynthesis of cobalamin (vitamin B₁₂), a critical cofactor in methyl transfer and nucleotide synthesis. The cobS gene (ca_cobalamin_operon) encodes a cobalamin synthase (EC 2.-.-.-) responsible for the final steps of vitamin B₁₂ assembly, including the incorporation of dimethylbenzimidazole into the corrin ring structure .

Genomic Context and Operon Organization

The cobS gene is part of a conserved cobalamin biosynthetic operon in C. acetobutylicum. Comparative genomic analyses reveal:

  • Operon Components: Includes cobA, cobO, cobS, and cobT homologs, aligning with canonical vitamin B₁₂ pathways .

  • Regulatory Elements: Predicted σ⁷⁰-dependent promoter upstream of the operon, with transcription termination signals indicating polycistronic mRNA production .

Research Applications and Challenges

While recombinant cobS is commercially available for biochemical studies , peer-reviewed research directly investigating its role in C. acetobutylicum remains limited. Key findings from related studies include:

  • Metabolic Engineering: C. acetobutylicum strains modified for enhanced solvent production (e.g., acetone-butanol-ethanol) often retain native cobalamin pathways, suggesting cobS is essential for central metabolism .

  • Sporulation Link: Polyketide metabolites (unrelated to cobS) regulate sporulation and solventogenesis in C. acetobutylicum, but cobS’s role in these processes is uncharacterized .

Future Directions

  • Structural Studies: High-resolution crystallography to resolve cobS’s active site and substrate-binding mechanisms.

  • Industrial Relevance: Explore cobS’s potential in synthetic biology platforms for vitamin B₁₂ production or metabolic engineering of solventogenic clostridia.

References Cited Cusabio datasheet for recombinant cobS (Product Code: CSB-YP405282DUC1). Transcriptional organization of the C. acetobutylicum genome (PMC390361). Metabolic engineering of Clostridium cellulovorans for n-butanol production (10.1128/AEM.02560-18). Co-cultivation studies with C. acetobutylicum (10.1093/jimb/kuac024).

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If a specific tag is required, please inform us, and we will prioritize its incorporation.
Synonyms
cobS; CA_C1384; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)
Target Names
cobS
Target Protein Sequence
MAFFRRLILMIQFLTRIPIKYESDITTEDFGKALALVPIVGLIIGGIMGVTYMLLVKVFF YKISAVLVLIEYIFLTGGIHLDGLGDTFDGVFSNRPKERILEIMRDSRVGTNAVLAVISV IILNYVILTEIDPAYMVKVIILFPVAGRLGSIVSASLSTYARRGEGMGKSFIDYCTLKEL AIGIILYAVIFLSVGLSRGYIIMIFPILTAVILIKYFTRKIGGATGDILGAVCELNQTFY LMTVYAVLYFRG
Uniprot No.

Target Background

Function
Recombinant *Clostridium acetobutylicum* Cobalamin Synthase (CobS) catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and α-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Cobalamin synthase (CobS) in Clostridium acetobutylicum?

Cobalamin synthase (CobS) serves as a critical enzyme in the cobalamin (vitamin B12) biosynthetic pathway of Clostridium acetobutylicum. Based on homology with characterized CobS enzymes from other organisms such as Salmonella typhimurium, it functions as a cobalamin(-5′-phosphate) synthase, catalyzing the assembly of the nucleotide loop of adenosylcobalamin from precursors including adenosylcobinamide-GDP and α-ribazole-5′-phosphate . This enzymatic step is essential for the production of functional cobalamin, which serves as a crucial cofactor for various metabolic processes in C. acetobutylicum, including the production of solvents during fermentation and methionine synthesis.

How does CobS protein topology relate to its function?

CobS in C. acetobutylicum has been characterized as a transmembrane protein with an N-terminal orientation classified as "N in/C out," meaning the N-terminus faces the cytoplasm while the C-terminus is oriented toward the periplasm . This specific orientation is crucial for proper enzymatic function, as it positions the catalytic domains appropriately within the cellular environment. The topology ensures that the active site can access the required substrates and facilitates the integration of CobS activity with other enzymes in the cobalamin biosynthetic pathway. The orientation has been experimentally determined using specialized fusion vectors that help distinguish between proteins with different membrane topologies .

What is known about the structural domains of CobS and how do they compare to other cobalamin-related enzymes?

While specific structural information for C. acetobutylicum CobS is limited, insights can be drawn from related cobalamin-processing enzymes. Cobalamin-dependent enzymes typically contain specialized domains for binding substrates and cofactors. For example, cobalamin-dependent methionine synthase contains a conserved cobalamin-binding domain (Cob) that carries the cobalamin cofactor, with adjacent domains that protect the reactive cofactor and interact with various substrates . By analogy, CobS likely possesses domains specialized for binding adenosylcobinamide-GDP and α-ribazole-5′-phosphate, facilitating their condensation to form adenosylcobalamin-5′-phosphate. These structural features would be critical for the enzyme's ability to participate in the complex molecular "juggling" required for multi-step catalytic processes in cobalamin biosynthesis .

What are the optimal conditions for recombinant expression of C. acetobutylicum CobS?

Recombinant expression of C. acetobutylicum CobS requires careful optimization of expression systems to maintain proper protein folding and membrane insertion. Based on approaches used for other recombinant C. acetobutylicum proteins, effective expression can be achieved using specialized vectors with inducible promoters adapted for Clostridium species or heterologous expression in E. coli . When expressing transmembrane proteins like CobS in E. coli, fusion vectors that accommodate the N-terminal orientation (N in/C out) of the protein should be selected . For optimal expression, considerations include:

  • Use of expression vectors with fusion partners compatible with the N-terminal orientation of CobS

  • Temperature control during induction (typically lower temperatures of 16-25°C to facilitate proper folding)

  • Implementation of dual antibiotic selection systems when working with multiple genetic modifications

  • Adaptation of induction parameters (inducer concentration and timing) to minimize toxicity while maximizing yield

These parameters must be experimentally determined for each specific construct and expression system employed.

How can researchers effectively determine the membrane topology of recombinant CobS?

Determining the membrane topology of recombinant CobS can be accomplished through a systematic approach using fusion vectors specifically designed for topology analysis. An effective methodology involves:

  • Cloning the CobS gene into dual expression vectors such as D94N (for N-terminal "in" orientation) and D94N-3TM (for N-terminal "out" orientation)

  • Assessing protein expression compatibility with each vector via Western blot analysis

  • Confirming C-terminal orientation using reporter tags such as β-lactamase (BlaM) for "out" orientation (conferring ampicillin resistance) or enhanced green fluorescent protein (EGFP) for "in" orientation (producing fluorescence)

  • Quantitative measurement of reporter activity to establish the predominant topological arrangement

This methodology has successfully demonstrated that CobS possesses an N in/C out orientation, which is critical information for designing expression systems and functional studies .

What analytical methods are effective for assessing CobS enzymatic activity in vitro?

Assessment of CobS enzymatic activity requires sophisticated analytical techniques that can detect the formation of adenosylcobalamin-5′-phosphate from its precursors. Based on methodologies employed for similar cobalamin synthases, a comprehensive analytical approach includes:

  • In vitro reaction system containing purified recombinant CobS, adenosylcobinamide-GDP (substrate), and α-ribazole-5′-phosphate (substrate) in appropriate buffer conditions

  • HPLC separation of reaction products using reverse-phase chromatography

  • UV-visible spectroscopy for initial identification based on the characteristic absorption spectrum of cobalamin compounds

  • Mass spectrometry confirmation of product identity and purity

  • Functional validation through complementation assays using cobalamin auxotrophs

This multi-faceted analytical approach enables researchers to definitively establish CobS activity and characterize reaction kinetics, substrate specificity, and cofactor requirements .

What strategies can overcome bottlenecks in recombinant CobS expression and solubilization?

Recombinant expression of membrane proteins like CobS presents significant challenges that require specialized approaches. Advanced strategies to overcome expression bottlenecks include:

  • Fusion Tag Optimization: Testing a panel of fusion tags (MBP, SUMO, thioredoxin) specifically selected for membrane protein expression

  • Membrane Mimetic Systems: Incorporation of detergents, nanodiscs, or membrane scaffolding proteins during purification to maintain native conformation

  • Co-expression with Chaperones: Simultaneous expression of molecular chaperones (e.g., GroEL/GroES) to facilitate proper folding

  • Cell-free Expression Systems: Utilizing cell-free systems with defined lipid compositions to bypass cellular toxicity issues

  • Directed Evolution Approaches: Developing CobS variants with improved expression characteristics while maintaining catalytic function

Each of these strategies requires thorough optimization and may be combined for synergistic effects to achieve functional expression of this challenging membrane protein.

How can researchers effectively integrate CobS modification with other genetic engineering approaches in C. acetobutylicum?

Integration of CobS modification with broader metabolic engineering in C. acetobutylicum requires sophisticated genetic approaches. A comprehensive strategy would include:

Successful implementation of these approaches has been demonstrated in C. acetobutylicum for other pathways, resulting in significant improvements in solvent production (e.g., 225 mM butanol, 76 mM acetone, and 57 mM ethanol) . Similar strategies applied to CobS could enhance cobalamin biosynthesis and potentially improve solvent production through increased cofactor availability.

What is the relationship between CobS activity and solvent production in engineered C. acetobutylicum strains?

The relationship between cobalamin biosynthesis (mediated by CobS) and solvent production in C. acetobutylicum represents a complex metabolic intersection that remains to be fully elucidated. Potential connections include:

  • Cofactor Availability: Enhanced cobalamin production through CobS optimization could increase the activity of B12-dependent enzymes involved in central carbon metabolism

  • Redox Balance: Alterations in cobalamin synthesis may affect the NAD+/NADH ratio, indirectly influencing solvent production pathways

  • Metabolic Flux Redirection: CobS optimization could redirect carbon flux through methionine synthesis and related pathways, potentially altering precursor availability for solvent formation

Experimental investigation of these relationships would require coordinated analysis of cobalamin levels, enzyme activities, and solvent production profiles in strains with modified CobS expression. This understanding could be particularly valuable for developing strains that overcome the typical butanol toxicity limit of 180 mM without requiring specific tolerance adaptations .

How do specific amino acid residues in CobS contribute to substrate binding and catalysis?

Analysis of the catalytic mechanism of CobS requires detailed understanding of key amino acid residues involved in substrate binding and catalysis. While specific structural information for C. acetobutylicum CobS is limited, comparative analysis with related cobalamin-processing enzymes suggests several critical features:

  • Histidine Residues: By analogy with other cobalamin-processing enzymes, histidine residues likely play crucial roles in cobalamin binding and catalysis, similar to His761 in methionine synthase which fine-tunes cobalamin reactivity

  • Arginine and Lysine Residues: Positively charged residues would facilitate binding of the negatively charged phosphate groups in the adenosylcobinamide-GDP substrate

  • Hydrophobic Pocket: A defined hydrophobic region would accommodate the dimethylbenzimidazole moiety of the α-ribazole-5′-phosphate substrate

Mutation studies targeting these predicted key residues would provide valuable insights into the structure-function relationships governing CobS activity.

What conformational changes occur in CobS during the catalytic cycle?

The catalytic cycle of CobS likely involves significant conformational changes to facilitate substrate binding, catalysis, and product release. Based on studies of related cobalamin-processing enzymes, these conformational changes may include:

  • Domain Rearrangements: Similar to the "molecular juggling" observed in methionine synthase, CobS may undergo large-scale domain movements to properly position substrates relative to catalytic residues

  • Cap Domain Movements: Analogous to the Cap domain in methionine synthase, CobS may contain protective domains that shield reactive intermediates during catalysis

  • Transition State Stabilization: Conformational changes would be required to stabilize the transition state during the formation of the nucleotide loop

Advanced biophysical techniques such as hydrogen-deuterium exchange mass spectrometry, small-angle X-ray scattering, and molecular dynamics simulations would be valuable for characterizing these conformational dynamics.

What is the comparative analysis of CobS enzymes across different Clostridium species?

A comparative analysis of CobS enzymes across Clostridium species reveals both conserved features essential for function and adaptations that may reflect species-specific metabolic requirements:

SpeciesProtein Length (aa)Transmembrane DomainsN-terminal OrientationKey Conserved MotifsUnique Features
C. acetobutylicum~250-2706N in/C outCobalamin binding, GDP bindingEnhanced expression under acidic conditions
C. beijerinckii~260-2806N in/C outCobalamin binding, GDP bindingExtended C-terminal domain
C. butyricum~240-2605-6N in/C outCobalamin binding, GDP bindingTruncated interdomain linker
C. ljungdahlii~270-2906-7Predicted N in/C outCobalamin binding, GDP bindingAdditional N-terminal extension

Note: This table represents predicted features based on limited available data and comparative genomics. Experimental validation is required to confirm these characteristics across different Clostridium species.

The conservation of transmembrane topology and key binding motifs across species highlights their fundamental importance to CobS function, while species-specific variations may relate to differences in metabolic capacity and environmental adaptation.

How can CobS engineering contribute to enhanced solvent production in C. acetobutylicum?

Strategic engineering of CobS could potentially enhance solvent production in C. acetobutylicum through several mechanisms:

  • Increased Cobalamin Availability: Optimization of CobS expression and activity could increase the availability of this essential cofactor for key metabolic enzymes

  • Metabolic Pathway Integration: Coordinated engineering of CobS alongside other genes involved in solvent production could create synergistic effects

  • Stress Response Modulation: Enhanced cobalamin synthesis may improve cellular stress responses during fermentation, potentially allowing cells to maintain solvent production under challenging conditions

Implementation of these strategies would require integration with established metabolic engineering approaches, such as those used to develop solvent super-producing strains through butyrate kinase gene inactivation and alcohol aldehyde dehydrogenase overexpression . The resulting strains could potentially exceed current production limits of 225 mM butanol, 76 mM acetone, and 57 mM ethanol .

What novel analytical approaches could advance our understanding of CobS structure and dynamics?

Cutting-edge analytical methods could significantly advance our understanding of CobS structure and dynamics:

  • Cryo-Electron Microscopy: Application of high-resolution cryo-EM to determine the three-dimensional structure of CobS within lipid environments

  • In-Cell NMR Spectroscopy: Development of isotope labeling strategies to study CobS dynamics in near-native cellular environments

  • Single-Molecule FRET: Implementation of fluorescence resonance energy transfer techniques to monitor real-time conformational changes during catalysis

  • Computational Approaches: Integration of molecular dynamics simulations with experimental data to model substrate binding and catalytic mechanisms

  • In Crystallo Catalysis: Capturing reaction intermediates through carefully timed substrate addition to crystallized CobS, similar to approaches used with other cobalamin-processing enzymes

These advanced methodologies could provide unprecedented insights into the structure-function relationships governing CobS activity and inform rational engineering approaches.

What are the most promising directions for CobS research in metabolic engineering applications?

The most promising future directions for CobS research in metabolic engineering applications include:

  • Pathway Optimization: Systematic engineering of the entire cobalamin biosynthetic pathway, with CobS as a key control point

  • Biosensor Development: Creation of cobalamin-responsive biosensors to facilitate high-throughput screening of CobS variants

  • Alternative Product Synthesis: Exploration of CobS engineering for the production of modified cobalamins with novel properties

  • Integration with Systems Biology: Development of genome-scale models that accurately represent the interconnections between cobalamin metabolism and solvent production

  • Synthetic Biology Applications: Design of minimal synthetic pathways incorporating optimized CobS variants for specific biotechnological applications

These research directions could ultimately contribute to the development of industrial strains with enhanced solvent production capabilities, overcoming current limitations such as butanol toxicity thresholds without requiring specific tolerance adaptations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.