Recombinant Clostridium acetobutylicum Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
lspA; CA_C2115; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)
Target Names
lspA
Target Protein Sequence
MEILVVAVGILVDRLTKIWALDKLKKVQDIPIIKNFFDLTYVENRGAAWGIFSGKTLVLS AVTLLVLSAIIVYMIKYRPKSKLARISLSLVISGALGNLYDRVFYKYVVDLFSLHYKDIY YYPVFNVADICVVVGTIMIAIFIVLKDDKKDGKV
Uniprot No.

Target Background

Function
This protein is a specific catalyst for the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the general function of Lipoprotein signal peptidase (LspA) in bacterial systems?

LspA is an aspartyl protease that performs the second step in the lipoprotein-processing pathway by cleaving the transmembrane helix signal peptide of lipoproteins, following lipidation by phosphatidylglycerol-prolipoprotein diacylglyceryl transferase (Lgt) . This process is essential for proper lipoprotein maturation and function. In bacterial systems, lipoproteins perform critical functions including signal transduction, stress sensing, virulence, cell division, nutrient uptake, and adhesion . The lipoprotein processing pathway is particularly important because it is essential in many organisms including Escherichia coli, Salmonella enterica, and Mycobacterium tuberculosis, while having no mammalian homologs .

How is LspA structurally characterized and what are its catalytic mechanisms?

LspA features a catalytic dyad comprising highly conserved aspartate residues surrounded by approximately 14 additional conserved residues that form the active site . Structural studies have shown that LspA contains a periplasmic helix (PH) that exhibits significant conformational flexibility on the nanosecond timescale . The enzyme operates through a β-cradle and PH that together "clamp" the substrate in place for catalysis . This structural arrangement allows LspA to adopt multiple conformations ranging from closed (occluding the active site from the lipid bilayer) to open (allowing substrate entry) . The conformational dynamics of LspA enable it to accommodate and process various lipoprotein substrates despite their structural diversity .

What techniques are commonly employed to study LspA structure and function?

Researchers typically employ a hybrid approach combining:

  • Molecular dynamics (MD) simulations to analyze conformational changes

  • Electron paramagnetic resonance (EPR) to study structural dynamics

  • Site-directed mutagenesis to identify critical residues

  • X-ray crystallography to determine protein structures (often with bound antibiotics like globomycin)

This multi-technique approach has revealed that LspA samples distinct conformations in different states (apo vs. bound), with the periplasmic helix exhibiting the highest root mean-square fluctuation during MD simulations .

What are optimal expression systems and vectors for recombinant C. acetobutylicum LspA?

For expression of recombinant C. acetobutylicum LspA, researchers should consider:

Expression SystemVectorTagsAdvantagesLimitations
E. coli BL21(DE3)pET28bN-terminal 6xHis with thrombin cleavage siteEstablished protocol for other LspA proteins; allows for IMAC purificationMay require optimization for C. acetobutylicum LspA
C. acetobutylicum native expressionpMTL80000 seriesC-terminal Strep-tagExpression in native environment; proper foldingLower yields; more complex cultivation
C. difficile inducible systemXylose-inducible vectorsCustomizableControlled expression; clostridioid-optimizedRequires xylose supplementation

Based on protocols used for P. aeruginosa LspA, incorporating an N-terminal 6xHis tag with a thrombin cleavage sequence in a pET28b vector has proven effective for recombinant expression . For C. acetobutylicum-specific expression, the cell preservation method is critical - cells harvested during stationary growth phase show higher survival ratios and better performance in subsequent cultivations .

What are key methodological considerations for purifying functional C. acetobutylicum LspA?

Purification of membrane proteins like LspA requires careful attention to maintaining the protein's native structure. A recommended protocol would include:

  • Cell lysis using either sonication or high-pressure homogenization in buffer containing protease inhibitors

  • Membrane fraction isolation through differential centrifugation

  • Membrane protein solubilization using appropriate detergents (FC12 has been successfully used for LspA from other species)

  • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

  • Size exclusion chromatography for further purification and buffer exchange

When working with C. acetobutylicum specifically, consider its anaerobic nature by including reducing agents in buffers and minimizing oxygen exposure during purification steps. For structural studies, verify protein activity and proper folding through functional assays before proceeding with more complex analyses .

How do the conformational dynamics of LspA influence its function in substrate processing?

The conformational flexibility of LspA is central to its ability to process diverse lipoprotein substrates. Based on molecular dynamics and EPR studies, LspA exhibits at least three distinct conformational states:

  • Closed conformation (dominant in apo state) - The periplasmic helix occludes the charged and polar active site residues from the hydrophobic membrane, with only 6.2 Å between the β-cradle and PH

  • Intermediate conformation (most populated in globomycin-bound state) - Represents a partially open state that may mimic the clamped substrate-bound configuration

  • Open conformation - Creates a trigonal cavity where lipoprotein substrate can sterically fit into the active site for signal peptide cleavage

These conformational states exist in equilibrium, with their relative populations shifting depending on substrate binding. The nanosecond timescale fluctuations of the periplasmic helix facilitate substrate recognition, binding, and catalysis .

What techniques provide the most insight into C. acetobutylicum LspA conformational changes?

To comprehensively analyze C. acetobutylicum LspA conformational dynamics, a hybrid experimental approach is recommended:

  • Molecular Dynamics (MD) Simulations: Implement in a lipid bilayer environment to observe conformational changes under native-like conditions. Analysis of root mean-square fluctuations can identify regions of highest mobility (typically the periplasmic helix) .

  • Site-Directed Spin Labeling (SDSL) with EPR Spectroscopy:

    • Continuous-wave (CW) EPR for analyzing nanosecond timescale motions

    • Double Electron-Electron Resonance (DEER) EPR for measuring longer-range distances between labeled sites

  • Strategic Selection of Labeling Sites:

    • PH region: Sites like A57R1 and A63R1 (based on P. aeruginosa numbering)

    • β-cradle: Sites like V41R1 and I43R1

    • These positions have shown significant spectral changes between apo and ligand-bound states

  • Crystallography: As a complementary technique to capture stable conformations, particularly when bound to inhibitors like globomycin .

This combined approach overcomes the limitations of any single technique and provides a more complete picture of the protein's dynamic behavior.

What CRISPR/Cas9 strategies are effective for editing the lspA gene in C. acetobutylicum?

CRISPR/Cas9 genome editing has revolutionized genetic manipulation in Clostridia. For C. acetobutylicum LspA engineering:

  • Established Systems: The cas9 gene from Streptococcus pyogenes has been successfully integrated into the C. acetobutylicum genome under the control of a xylose-inducible system from Clostridium difficile .

  • Target Selection: Design guide RNAs targeting the lspA gene with minimal off-target effects. For membrane proteins like LspA, consider targeting regions that affect:

    • Catalytic residues to study enzymatic function

    • Periplasmic helix to investigate conformational dynamics

    • Substrate binding domains to alter specificity

  • Delivery Method: For C. acetobutylicum, electroporation of ribonucleoprotein complexes (Cas9 protein and guide RNA) followed by selection has shown efficiency in other Clostridial species.

  • Verification: Confirm edits through sequencing and functional assays specific to LspA activity.

When implementing these methods, researchers should be mindful that LspA is likely essential in C. acetobutylicum as it is in other gram-negative bacteria, meaning complete knockouts may not be viable without complementation .

How can researchers design site-directed mutagenesis experiments to investigate C. acetobutylicum LspA function?

Site-directed mutagenesis represents a powerful approach to investigate the structure-function relationship of LspA:

  • Target Selection:

    • Catalytic dyad residues (aspartates) to confirm enzymatic mechanism

    • 14 highly conserved residues surrounding the active site to investigate substrate specificity

    • Periplasmic helix residues to study conformational dynamics

  • Methodological Approaches:

    • PIPE Mutagenesis or QuikChange for simple amino acid substitutions

    • Gibson Assembly for more complex modifications

    • Codon optimization for efficient expression in heterologous systems

  • Functional Analysis Framework:

    • Enzymatic activity assays using fluorogenic substrates

    • Conformational analysis through EPR with spin-labeled variants

    • Binding studies with known LspA inhibitors (e.g., globomycin)

    • In vivo complementation tests in LspA-deficient strains

  • Interpretation Guidelines:

    • Consider the extensive conservation of LspA active site residues

    • Mutations affecting antibiotic binding may also interfere with substrate binding and cleavage

    • Correlate structural impacts with functional outcomes

How might C. acetobutylicum LspA be employed in antibiotic resistance studies?

C. acetobutylicum LspA represents a valuable model for investigating antibiotic targets due to several key characteristics:

  • Target Suitability: LspA is an excellent antibiotic target because it is essential in Gram-negative bacteria, important for virulence in Gram-positive bacteria, and has no mammalian homologs .

  • Resistance Development: The extensive conservation of active site residues suggests that resistance mutations affecting antibiotic binding would likely interfere with substrate binding and enzymatic function, potentially reducing fitness .

  • Experimental Approaches:

    • Generate C. acetobutylicum strains with modified LspA and assess antibiotic susceptibility

    • Study binding modes of known LspA inhibitors (globomycin, myxovirescin) through structural and biophysical methods

    • Screen for novel inhibitors using recombinant C. acetobutylicum LspA

  • Comparative Analysis: Investigate differences between LspA from various species including Pseudomonas aeruginosa and Staphylococcus aureus to identify species-specific vulnerabilities .

What approaches can elucidate the relationship between C. acetobutylicum LspA and solvent production/tolerance?

Given C. acetobutylicum's industrial importance in solvent production, understanding LspA's potential role represents an intriguing research direction:

  • Investigation Framework:

    • Generate conditional LspA mutants to study effects on solvent production

    • Analyze lipoprotein profiles under different fermentation conditions

    • Examine how membrane integrity, affected by proper lipoprotein processing, correlates with solvent tolerance

  • Methodological Considerations:

    • Implement xylose-inducible systems for controlled LspA expression

    • Monitor both acidogenic and solventogenic phases for phenotypic changes

    • Combine with transcriptomic/proteomic analyses to identify regulatory networks

  • Connection to Solvent Production Pathways:

    • Examine potential links between lipoprotein processing and the Spo0A regulatory network, which controls both solvent formation and sporulation genes

    • Investigate whether membrane-associated lipoproteins play roles in solvent export or tolerance mechanisms

As solvent tolerance is a major limiting factor in industrial butanol production, any mechanistic insights connecting LspA function to membrane integrity could have significant biotechnological applications .

What controls are essential when characterizing recombinant C. acetobutylicum LspA?

Robust experimental design requires appropriate controls:

Control TypePurposeImplementation
Negative controlsVerify assay specificityInactive LspA mutants (catalytic dyad mutations); heat-denatured enzyme
Positive controlsConfirm assay functionalityWell-characterized LspA from model organisms (P. aeruginosa LspA)
Vehicle controlsAccount for solvent effectsDMSO controls for inhibitor studies (critical as DMSO can impact CW EPR spectra)
Expression controlsVerify proper foldingWestern blot analysis; activity assays with known substrates
Substrate controlsValidate specificityNon-lipoprotein controls; pre-processed substrates

Additionally, when conducting EPR studies with inhibitors like globomycin, researchers should be aware that DMSO (commonly used for inhibitor solubilization) can significantly impact CW spectra. A recommended protocol involves aliquoting globomycin, drying it in a lyophilizer, and then resuspending with spin-labeled LspA samples directly .

How should researchers interpret conflicting data when studying C. acetobutylicum LspA conformational dynamics?

When faced with seemingly contradictory results:

  • Consider Technique Limitations:

    • Crystal structures capture stable conformations but may miss transient states

    • MD simulations depend on force fields and initial conditions

    • EPR detects populations above certain thresholds, potentially missing minor conformations

  • Reconciliation Approaches:

    • Combine multiple experimental techniques to overcome individual limitations

    • The observed "open" conformation in MD simulations may not be detected in experimental DEER data if its population is too small or not stabilized in the chosen membrane mimic

    • Two-component CW line shapes and multiple distance populations in DEER suggest sampling of multiple conformations (closed, intermediate, open) with varying populations in different states

  • Analytical Framework:

    • Population distributions rather than discrete states often better represent membrane protein dynamics

    • Consider environmental factors (detergents, lipid composition, temperature) that may shift conformational equilibria

  • Validation Strategy:

    • Design experiments specifically to detect minor populations

    • Use kinetic approaches to trap transient conformations

    • Implement functional assays to correlate structural observations with activity

Understanding that LspA likely samples multiple conformations with populations that vary depending on substrate binding and environmental conditions provides a framework for reconciling apparently conflicting data .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.