Recombinant Clostridium acetobutylicum Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. Please specify your desired tag type for preferential development.
Synonyms
kdpC; CA_C3680; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)
Target Names
kdpC
Target Protein Sequence
MKYFKSALRLGIVLIIICGLIYPLFITAVGQTVFHNKANGSIVTFKGKEVGSALLGQNFT DKRFFRGRVSSVNYNTYTKNDSNKDEVASGSQNLAPSNKDLKNRVKKDIDDFLKTHPGVK KDEIPTDLLTSSGSGLDPDISPKAAEIQVPSVSKATGISQSKLKQIIKKCTEGRTLGVLG EERVNVLKVNLEVASMLKNSKIGE
Uniprot No.

Target Background

Function

This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit (KdpC) functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit (KdpB) through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links
Protein Families
KdpC family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the KdpC protein in Clostridium acetobutylicum and how does it differ from other bacterial species?

The KdpC protein in Clostridium acetobutylicum is a 204 amino acid protein with a calculated molecular weight of 22,187 Da, encoded by a 612 bp gene . It functions as part of the KdpFABC complex, which is a specialized high-affinity potassium transport system activated under potassium-limited conditions.

Unlike the well-characterized KdpC proteins in Enterobacteria, the C. acetobutylicum KdpC shows several significant structural differences. Comparative analysis reveals that while the KdpC protein maintains its core functional role across bacterial species, the C. acetobutylicum version has evolved distinct sequence variations that likely reflect adaptation to the anaerobic lifestyle and unique potassium requirements of clostridia .

To study these differences methodologically:

  • Perform multiple sequence alignment using CLUSTAL W

  • Generate phylogenetic trees to visualize evolutionary relationships

  • Use homology modeling based on known structures (such as the prokaryotic KdpFABC structures) to predict structural differences

How is the KdpFABC complex organized in C. acetobutylicum and what is its mechanism of action?

The KdpFABC complex in C. acetobutylicum represents a fascinating hybrid system that combines elements of both channels and pumps. Similar to other prokaryotic systems, it likely comprises:

  • KdpA: A channel-like subunit from the superfamily of K+ transporters

  • KdpB: A pump-like subunit from the superfamily of P-type ATPases

  • KdpC: A stabilizing peripheral membrane protein

  • KdpF: A small regulatory peptide

The mechanism of action appears to involve ATP hydrolysis coupled to K+ transfer between alternative binding sites. Recent structural data from similar prokaryotic KdpFABC complexes suggest that K+ transport occurs through an intramembrane tunnel in KdpA, delivering ions to sites in the membrane domain of KdpB. This pathway includes a series of binding sites for K+ that ultimately connect to a water-filled pathway allowing release of K+ to the cytoplasm .

What methods are used to clone and express the kdpC gene from C. acetobutylicum?

The methodological approach for cloning and expressing the kdpC gene involves:

  • Genomic DNA isolation: Extract genomic DNA from C. acetobutylicum DSM 792 grown under strictly anaerobic conditions at 37°C in clostridial basal medium or minimal medium .

  • PCR amplification: Design primers based on the known sequence (GenBank accession no. U44892) to amplify the kdpC gene .

  • Cloning strategy:

    • Generate a DNA probe by PCR using a specific primer pair

    • Screen genomic libraries of C. acetobutylicum

    • Identify positive clones through hybridization experiments

    • Subclone the gene into an appropriate expression vector

  • Expression optimization:

    • For heterologous expression in E. coli, consider codon optimization

    • For homologous expression, utilize inducible promoters responsive to potassium deficiency

    • Include an affinity tag (His-tag) for purification purposes

  • Protein purification:

    • Ni-NTA affinity chromatography followed by size-exclusion chromatography

    • Use buffers containing approximately 25 mM Tris pH 7.5, 10% glycerol, 1 mM reducing agent, 100 mM NaCl, and appropriate detergent (e.g., 0.15% n-decyl-β-maltoside)

How does the P-type ATPase activity in the KdpFABC complex of C. acetobutylicum compare to other P-type ATPases?

The P-type ATPase activity in C. acetobutylicum's KdpFABC complex exhibits notable similarities and differences compared to other P-type ATPases like the Ca²⁺-ATPase (SERCA) and Na⁺,K⁺-ATPase:

  • Reaction cycle similarities: The KdpB subunit likely undergoes conformational changes consistent with the Post-Albers cycle typical of P-type ATPases, involving E1 and E2 states with phosphorylation at a conserved aspartic acid residue .

  • Catalytic site architecture: The catalytic mechanism involves:

    • ATP binding in the N-domain

    • Phosphoryl transfer to an aspartate in the P-domain

    • Conformational changes mediated by the A-domain, which contains the conserved TGES motif involved in dephosphorylation

  • Key differences: Unlike Na⁺,K⁺-ATPase which transports three Na⁺ out and two K⁺ in, the KdpFABC complex specializes only in K⁺ uptake . Additionally, the dephosphorylation kinetics may differ due to structural variations in critical loops compared to Ca²⁺-ATPase .

Methodological approaches to study these differences include:

  • Coupled enzyme assays to measure ATPase activity

  • Site-directed mutagenesis of conserved residues

  • Voltage-sensitive dye assays to monitor electrogenic K⁺ transport

  • Structural analysis using cryo-EM to capture different conformational states

What role does KdpC play in genetic engineering strategies for improved butanol production in C. acetobutylicum?

While the KdpC protein is not directly involved in butanol production pathways, manipulation of the potassium transport system could potentially enhance solvent production in recombinant C. acetobutylicum strains through several mechanisms:

  • Ionic homeostasis maintenance: Optimizing potassium transport can improve cellular response to stress conditions during fermentation, potentially allowing for increased butanol tolerance and production .

  • Metabolic flux redirection: Changes in ionic gradients affect various metabolic pathways. Strategic manipulation of the KdpFABC complex could potentially be combined with other genetic modifications (such as inactivation of the butyrate kinase gene and overexpression of alcohol aldehyde dehydrogenase) to enhance butanol production .

  • Strain stability: Improving potassium uptake systems might enhance the stability of recombinant strains carrying multiple genetic modifications under dual antibiotic selection .

Current strategies typically focus on direct pathway engineering, such as:

  • Inactivating the butyrate kinase gene (buk)

  • Overexpressing the aad gene (encoding alcohol aldehyde dehydrogenase)

  • Combined genetic modifications that have achieved butanol production levels of 225 mM (16.7 g/L), exceeding the typical 180 mM (13 g/L) toxicity limit

What structural analysis techniques are most effective for studying the KdpC protein and its interactions within the KdpFABC complex?

Multiple complementary approaches are recommended for comprehensive structural analysis:

  • Cryo-electron microscopy (cryo-EM):

    • Most effective for determining the structure of the entire KdpFABC complex

    • Can capture different conformational states by using substrate analogs to stabilize specific reaction intermediates

    • Analysis protocols include:

      • Plunge freezing samples on Ultrafoil grids

      • Imaging using a Titan Krios electron microscope

      • Structure determination using cryoSPARC

      • Atomic model refinement using PHENIX

  • X-ray crystallography:

    • Challenges include obtaining well-diffracting crystals of membrane protein complexes

    • Requires detergent screening and potentially the use of antibody fragments or nanobodies as crystallization chaperones

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Valuable for mapping protein-protein interaction interfaces

    • Can identify regions of KdpC that interact with other subunits

  • Cross-linking mass spectrometry:

    • Helps identify spatial relationships between different regions of the complex

    • Provides distance constraints for computational modeling

  • Molecular dynamics simulations:

    • Based on experimental structures to model protein dynamics

    • Can analyze internal cavities using software like Caver Analyst 2.0

How do mutations in the KdpC protein affect the assembly and function of the KdpFABC complex?

Mutations in KdpC can significantly impact both assembly and function of the KdpFABC complex through several mechanisms:

  • Complex assembly effects:

    • KdpC likely plays a stabilizing role in the complex

    • Mutations in interface regions can disrupt proper assembly

    • Systematic alanine scanning mutagenesis can identify critical residues

  • Functional consequences:

    • Altered KdpC may affect the conformational changes of KdpB during the reaction cycle

    • Changes in the positioning of transmembrane segments could affect ion selectivity and transport

  • Methodological approaches:

    • Site-directed mutagenesis to create specific mutations

    • Expression analysis using Western blotting to assess protein levels

    • Membrane fractionation to determine proper membrane insertion

    • ATPase activity assays to assess functional impact

    • Potassium transport assays using either voltage-sensitive dyes or capacitative coupling measurements with systems like SURFE²R N1

  • Data interpretation:

    • Compare wild-type vs. mutant kinetic parameters

    • Assess thermal stability differences

    • Analyze structural changes using the techniques described in section 2.3

What are the comparative characteristics of the kdp operon in C. acetobutylicum versus other bacterial species?

The kdp operon in C. acetobutylicum exhibits several distinctive features compared to other bacterial species:

FeatureC. acetobutylicumE. coliM. tuberculosisSynechocystis
Gene OrderkdpFABC-DEkdpFABCDEkdpFABCDEkdpABCDE
KdpC Size204 aa, 22.2 kDa~190 aa, ~21 kDa~220 aa, ~24 kDa~200 aa, ~22 kDa
Regulatory ElementsDistinct from enterobacterial complexWell-characterized two-component systemSimilar to E. coliUnique adaptations
Expression ControlResponds to K⁺ deficiencyK⁺ deficiency via KdpDE two-component systemComplex regulationEnvironmental response
Genomic ContextShows significant differencesWell-conservedSimilar to E. coliUnique adaptations

Research methodologies to study these differences include:

  • Comparative genomics and phylogenetic analysis

  • Transcriptomic profiling under various potassium concentrations

  • Promoter activity assays using reporter gene fusions

  • DNA-protein interaction studies to characterize regulatory elements

  • Gene deletion and complementation experiments

What are the optimal conditions for heterologous expression of recombinant C. acetobutylicum KdpC?

Optimizing heterologous expression of recombinant C. acetobutylicum KdpC requires careful consideration of several parameters:

  • Expression system selection:

    • E. coli: BL21(DE3) or C43(DE3) strains are recommended for membrane-associated proteins

    • Bacillus subtilis: Consider for better expression of Gram-positive proteins

    • Yeast systems: May provide better folding for complex membrane proteins

  • Vector design:

    • Include affinity tags (His₆, FLAG, or Strep-tag II) for purification

    • Consider fusion partners (MBP, SUMO) to enhance solubility

    • Incorporate TEV or PreScission protease sites for tag removal

  • Expression conditions optimization:

    • Temperature: Lower temperatures (16-25°C) often improve proper folding

    • Induction: IPTG concentration between 0.1-0.5 mM for T7-based systems

    • Media: Rich media (2XYT, TB) or minimal media depending on application

    • Duration: Extended expression times (16-24 hours) at lower temperatures

  • Extraction and purification strategy:

    • Membrane fraction isolation using ultracentrifugation

    • Solubilization screening with different detergents:

      • n-Dodecyl-β-D-maltoside (DDM)

      • n-Decyl-β-D-maltoside (DM)

      • Digitonin

      • LMNG (Lauryl Maltose Neopentyl Glycol)

    • Purification using Ni-NTA affinity followed by size exclusion chromatography

  • Quality assessment:

    • SDS-PAGE and Western blotting

    • Mass spectrometry for identity confirmation

    • Circular dichroism for secondary structure analysis

    • Functional assays to confirm activity

How can metabolic flux analysis be applied to study the impact of KdpC function on C. acetobutylicum metabolism?

  • Experimental design:

    • Create kdpC knockout, overexpression, and site-directed mutant strains

    • Grow cultures under controlled conditions with varying potassium concentrations

    • Perform fermentations at controlled pH (≥5.0) similar to conditions used for recombinant C. acetobutylicum strains

  • 13C-labeling strategies:

    • Feed cultures with 13C-labeled glucose

    • Measure isotope enrichment in metabolites using GC-MS or LC-MS/MS

    • Calculate flux distributions using isotopomer balancing

  • Metabolite quantification:

    • Monitor key metabolites including:

      • Acetone, butanol, and ethanol (ABE)

      • Organic acids (acetate, butyrate)

      • Intracellular potassium concentrations

    • Track shifts in the onset of solvent production, which normally occurs during exponential growth phase with low culture optical density

  • Data analysis and interpretation:

    • Compare flux distributions between wild-type and modified strains

    • Examine changes in butyrate and acetate formation fluxes

    • Quantify specific butanol and ethanol formation fluxes, which have shown increases of up to 300% and 400%, respectively, in certain recombinant strains

  • Integration with transcriptomics/proteomics:

    • Correlate flux changes with alterations in gene/protein expression

    • Identify regulatory nodes affecting the relationship between potassium homeostasis and solvent production

What techniques are most effective for studying the role of KdpC in potassium transport kinetics?

To thoroughly investigate KdpC's role in potassium transport kinetics, combine these complementary approaches:

  • Direct transport measurements:

    • Radioisotope uptake assays: Use 42K+ or 86Rb+ (as K+ analog) to directly measure transport rates

    • Voltage-sensitive fluorescent dyes: Monitor membrane potential changes with dyes like DisC3

    • Capacitative coupling: Employ systems like SURFE2R N1 (Nanion Technologies) to measure electrogenic transport activity

  • Biochemical characterization:

    • ATPase activity assays: Use coupled enzyme systems to measure ATP hydrolysis rates under varying conditions

    • Phosphorylation assays: Monitor formation of phosphorylated intermediates using [γ-32P]ATP

    • K+ dependence studies: Determine the K+ dependence of Na+,K+-ATPase activity at varying concentrations (e.g., 20-130 mM)

  • Structural approaches:

    • Site-directed mutagenesis: Create targeted mutations in KdpC and assess their impact on transport

    • Crosslinking studies: Identify interaction interfaces between KdpC and other complex components

    • Conformational state analysis: Use substrate analogs to stabilize different enzymatic states for structural studies

  • Computational methods:

    • Molecular dynamics simulations: Model potassium movement through transport pathways

    • Electrostatic calculations: Assess the role of charged residues in ion selectivity

    • Quantum mechanics/molecular mechanics: Examine the energetics of potassium binding sites

How should contradictory structural data about the KdpFABC complex be reconciled in research?

Addressing contradictory structural data about the KdpFABC complex requires a systematic approach:

  • Critical assessment of methodologies:

    • Evaluate resolution limits of each structural determination method

    • Consider sample preparation differences (detergents, lipid composition)

    • Assess the physiological relevance of conditions used for structure determination

    • Compare structures stabilized with different substrate analogs

  • Reconciliation strategies:

    • Map contradictory regions onto structures and assess functional significance

    • Consider that different structures may represent distinct states in the transport cycle

    • Use map comparison tools (e.g., EMDA from CCP-EM software) to quantitatively assess differences

    • Employ multiple structural biology techniques to generate complementary data

  • Validation experiments:

    • Design site-directed mutagenesis experiments targeting controversial regions

    • Perform crosslinking studies to verify proximity relationships

    • Use spectroscopic methods (EPR, FRET) to measure distances between key residues

    • Test functional predictions arising from each structural model

  • Integration with functional data:

    • Correlate structural features with kinetic measurements

    • Compare with homologous systems like Na+,K+-ATPase or Ca2+-ATPase

    • Consider evolutionary conservation patterns as functional constraints

What bioinformatic approaches are most valuable for analyzing the evolutionary relationships of KdpC across different bacterial species?

To comprehensively analyze evolutionary relationships of KdpC across bacterial species:

  • Sequence-based analyses:

    • Multiple sequence alignment: Use MUSCLE or MAFFT algorithms to align KdpC sequences

    • Phylogenetic tree construction: Employ maximum likelihood (RAxML, IQ-TREE) or Bayesian inference methods

    • Conservation analysis: Calculate position-specific conservation scores using ConSurf or similar tools

    • Coevolution analysis: Identify correlated mutations using methods like statistical coupling analysis

  • Structure-informed approaches:

    • Homology modeling: Generate structural models for KdpC from diverse species

    • Structural alignment: Compare predicted or experimental structures

    • Binding site prediction: Identify conserved interaction interfaces

    • Molecular dynamics: Simulate conformational flexibility across homologs

  • Genomic context analysis:

    • Operon structure comparison: Analyze gene order and organization across species

    • Synteny analysis: Examine conservation of flanking genes

    • Horizontal gene transfer detection: Use composition-based methods to identify potential HGT events

    • Regulatory element comparison: Identify conserved promoter and regulatory sequences

  • Integration with experimental data:

    • Correlate evolutionary patterns with functional differences

    • Test predictions using targeted mutagenesis experiments

    • Validate structural models through biochemical assays

What emerging technologies could advance our understanding of KdpC function in C. acetobutylicum?

Emerging technologies with significant potential to advance KdpC research include:

  • Single-molecule approaches:

    • FRET-based conformational studies: Monitor real-time conformational changes during transport cycles

    • Single-molecule force spectroscopy: Measure interaction strengths between complex components

    • Nanopore recording: Potentially monitor ion transport events through reconstituted complexes

  • Advanced structural methods:

    • Time-resolved cryo-EM: Capture short-lived conformational states during transport

    • Micro-electron diffraction (MicroED): Determine structures from microcrystals

    • Integrative structural biology: Combine multiple data types (cryo-EM, crosslinking MS, SAXS) for complete models

  • Genomic and synthetic biology tools:

    • CRISPR-Cas9 genome editing: Create precise mutations in C. acetobutylicum

    • High-throughput mutagenesis: Systematically assess the impact of mutations across the protein

    • Minimal synthetic transport systems: Engineer simplified versions to understand core mechanisms

  • Advanced computational approaches:

    • Machine learning for structure prediction: Improve accuracy of structural models

    • Enhanced sampling molecular dynamics: Access longer timescales relevant to transport cycles

    • Systems biology modeling: Integrate potassium transport with whole-cell metabolic models

How might research on C. acetobutylicum KdpC contribute to biotechnological applications?

Research on C. acetobutylicum KdpC has several promising biotechnological applications:

  • Improved biofuel production:

    • Engineering strains with enhanced potassium homeostasis may increase butanol tolerance and production yields

    • Integration with other genetic modifications (like butyrate kinase inactivation) could create superproducer strains exceeding current butanol production limits of 225 mM (16.7 g/L)

  • Biosensor development:

    • KdpFABC components could be engineered as potassium biosensors for environmental monitoring

    • Applications in detecting potassium levels in fermentation processes

  • Antimicrobial development:

    • Understanding unique features of the C. acetobutylicum potassium transport system could reveal targets for selective inhibition

    • Potential applications in controlling clostridial infections

  • Protein engineering platforms:

    • The KdpFABC complex represents a unique hybrid of channel and pump mechanisms

    • Could serve as a template for designing novel transport proteins with customized properties

    • Potential applications in synthetic biology and bioelectronic interfaces

  • Stress-resistant industrial strains:

    • Knowledge of potassium transport mechanisms could inform engineering of industrial microorganisms with enhanced osmotic stress resistance

    • Applications in improving fermentation processes under challenging conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.