Recombinant Clostridium acetobutylicum Probable sporulation sigma-E factor-processing peptidase (spoIIGA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Sporulation

spoIIGA is integral to the C. acetobutylicum sporulation cascade, which diverges from the Bacillus subtilis model. Key insights include:

Sporulation Regulation

  • Sigma Factor Activation: In B. subtilis, sporulation proceeds via sequential activation of sigma factors (σH → σF → σE → σG → σK). In C. acetobutylicum, σK exhibits dual roles (early and late stages) .

  • spoIIGA’s Role: Processes sigma-E, enabling transcriptional activation of downstream genes (e.g., sigG and spoIIIG) .

Dependence on Spo0A

  • spo0A is a master regulator of sporulation and solventogenesis. Inactivation of spo0A (e.g., strain SKO1) blocks sporulation and reduces solvent production .

  • Overexpression of Spo0A accelerates sporulation and upregulates spoIIGA, sigE, and sigG expression, suggesting a hierarchical regulatory network .

Key Studies

  1. spo0A Overexpression

    • Strain 824(pMPSOA) (overexpressing spo0A) exhibited earlier spoIIGA transcription and enhanced sporulation compared to wild-type .

    • spoIIGA expression correlated with elevated spore density in cultures .

  2. spo0A Inactivation

    • Strain SKO1 (Δspo0A) showed no spoIIGA transcription, resulting in filamentous cells and no sporulation .

  3. Autolysis and Sporulation

    • Spontaneous autolysis in C. acetobutylicum provides nutrients for sporulating cells, indirectly influencing spore yield .

Industrial and Laboratory Uses

ApplicationDetail
ELISA AssaysDetects spoIIGA levels to study sporulation dynamics
Strain EngineeringModulating spoIIGA expression to optimize spore production in bioreactors
Solventogenesis ControlBalancing solvent production (e.g., butanol, acetone) with sporulation via spo0A-mediated regulation

Challenges

  • Genetic Uncoupling: spo0A deletion disrupts both sporulation and solventogenesis, complicating strain optimization .

  • Autolysis Trade-offs: High autolysis rates may reduce cell density but enhance spore formation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a reference for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please inform us of any specific tag requirements for preferential development.
Synonyms
spoIIGA; CA_C1694; Probable sporulation sigma-E factor-processing peptidase; Membrane-associated aspartic protease; Stage II sporulation protein GA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)
Target Names
spoIIGA
Target Protein Sequence
MVIYLDVLIFENSIVNTFLLYITAQTLRIKVKMRYLILAGIFGGLYVIVLVIPTLKIFSS LIFKIIAAFLMIIICFRKKSLRFNIKALAVLIMYSMVTAGLCFFIELNNTRGSYFNAFIG NVSYKWILIAIMIIYMFVNRIIWFINDRKLTQSLIYEIEICFKDNSKFINAFLDTGNELR EPITNLPVIVVEKDMVSGIKWDDCPKFYVPFRLFNGKAGNLEAFKPSYVKIYIGDKVEVR NAIIALIDNKLSSLNDYNALLSRGSI
Uniprot No.

Target Background

Function

This probable aspartic protease is responsible for the proteolytic cleavage of the RNA polymerase sigma E factor (SigE/spoIIGB) during sporulation in the mother cell. This cleavage yields the active peptide. The protease responds to a forespore signal triggered by the extracellular signal protein SpoIIR.

Database Links
Protein Families
Peptidase U4 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SpoIIGA and what is its fundamental role in bacterial sporulation?

SpoIIGA is a protein essential for bacterial sporulation that functions as a membrane-bound protease responsible for converting pro-sigma E (an inactive precursor) into its active form, sigma E. In model organisms like Bacillus subtilis, SpoIIGA has been experimentally confirmed as a membrane-associated protein that plays a critical role in the sporulation cascade. Differential centrifugation experiments with SpoIIGA-lacZ fusion proteins have demonstrated that SpoIIGA activity is predominantly associated with the membrane fraction of cell extracts, specifically in a Triton X-100-sensitive, fast-sedimenting portion . This stands in contrast to the sigma E precursor (encoded by spoIIGB), which remains primarily in the cytoplasmic supernatant fraction . The membrane localization of SpoIIGA is consistent with its proposed function as the protease that processes pro-sigma E during the early stages of sporulation.

Methodologically, researchers investigating SpoIIGA should consider subcellular fractionation techniques coupled with activity assays to confirm both localization and function of this protein in their specific bacterial system.

How does sporulation regulation in Clostridium acetobutylicum differ from the Bacillus subtilis model?

Additional differences are evident in the phenotypic consequences of gene disruptions. In B. subtilis, disruption of sigE results in cells that form normal sporulation septa but exhibit a disporic phenotype . Contrastingly, in C. acetobutylicum, sigE disruption blocks sporulation prior to asymmetric division, with no disporic cells or granulose accumulation observed . This suggests fundamentally different dependencies within the sporulation cascade between these two species.

For researchers studying SpoIIGA in C. acetobutylicum, these differences highlight the importance of not simply extrapolating B. subtilis models but rather conducting species-specific investigations of the sporulation pathway.

What experimental approaches are most effective for studying SpoIIGA expression and activity?

Based on published research methodologies, several approaches have proven effective for studying SpoIIGA:

  • Reporter gene fusions: Creating translational fusions with reporter genes like lacZ has been successfully employed to monitor SpoIIGA expression and localization. In B. subtilis studies, researchers joined the E. coli lacZ gene to the 3' end of spoIIGA as a translational fusion, creating a chimeric protein with both beta-galactosidase and SpoIIGA activities . This approach allowed quantification of relative protein levels and subcellular localization.

  • Promoter activity analysis: For studying expression patterns, chloramphenicol acetyltransferase (CAT) or β-galactosidase reporter systems can be employed to monitor promoter activity. This approach was successfully used to study the spoIIE promoter in C. acetobutylicum .

  • Differential centrifugation: To determine subcellular localization, differential centrifugation of bacterial extracts containing fusion proteins provides evidence of membrane association. SpoIIGA-lacZ fusion protein activity was found predominantly in the membrane fraction, supporting its proposed membrane localization .

  • Disruption and overexpression studies: Creating strains with disrupted spoIIGA or with overexpression/antisense constructs can reveal the functional role of SpoIIGA in sporulation and related processes, similar to approaches used for studying spoIIE in C. acetobutylicum .

How does SpoIIGA activity correlate with the timing of sporulation events in C. acetobutylicum?

The timing of SpoIIGA activity in C. acetobutylicum must be understood within the context of the organism's unique sporulation cascade. While specific data on SpoIIGA timing in C. acetobutylicum is limited in the provided research, insights can be gained from related studies on sporulation genes.

In C. acetobutylicum, the spoIIE promoter shows transient activity during late solventogenesis, which corresponds to the transition from vegetative growth to sporulation . This expression is Spo0A-dependent, as demonstrated by the lack of spoIIE promoter activity in spo0A-deleted strains . Given that both spoIIE and spoIIGA are involved in early sporulation events, researchers should investigate whether spoIIGA follows a similar expression pattern.

A methodological approach to determine SpoIIGA timing would involve:

  • Creating reporter constructs with the spoIIGA promoter

  • Monitoring expression throughout the growth cycle, particularly during the transition to solventogenesis and sporulation

  • Comparing expression patterns in wild-type and sporulation-deficient mutants (e.g., spo0A mutants)

  • Correlating expression with morphological changes using microscopy

What functional consequences result from genetic manipulation of spoIIGA in C. acetobutylicum?

While the search results don't provide direct information on spoIIGA manipulation in C. acetobutylicum, we can draw parallels from studies on spoIIE. Antisense RNA-mediated downregulation of spoIIE in C. acetobutylicum resulted in:

  • Significant delay in sporulation

  • Altered morphology of sporulating cells

  • Prolonged solventogenesis

  • Dramatically increased solvent production (ethanol +225%, acetone +43%, butanol +110%)

These findings suggest that manipulating early sporulation genes can substantially impact both sporulation and solvent production. Researchers interested in spoIIGA manipulation should consider similar approaches:

  • Creating antisense RNA constructs targeting spoIIGA

  • Developing overexpression strains

  • Creating precise deletion or point mutations in spoIIGA

  • Monitoring effects on:

    • Sporulation timing and morphology

    • Solvent production profiles

    • Cell physiology and stress response

StrainEthanol ProductionAcetone ProductionButanol ProductionSporulation Phenotype
Wild typeBaselineBaselineBaselineNormal
spoIIE antisense+225%+43%+110%Significantly delayed, altered morphology
Potential spoIIGA antisenseTo be determinedTo be determinedTo be determinedHypothesized disruption at early stage

What methodological approaches can resolve the membrane topology and protease domain structure of SpoIIGA?

Understanding the structure-function relationship of SpoIIGA requires elucidating its membrane topology and identifying its protease domain. Based on research with B. subtilis SpoIIGA, which is hypothesized to be both membrane-bound and functioning as a protease , several methodological approaches would be valuable:

  • Membrane protein topology mapping:

    • Construct fusion proteins with topology reporters (PhoA, GFP) at various positions

    • Use protease accessibility assays to determine exposed regions

    • Apply cysteine scanning mutagenesis with membrane-impermeable sulfhydryl reagents

  • Domain function analysis:

    • Create domain deletion and point mutation variants

    • Express and purify domains separately to test for protease activity

    • Perform complementation assays with domain-swapped constructs

  • Structural analysis:

    • Use computational predictions to identify transmembrane regions and catalytic domains

    • Attempt crystallization of soluble domains for X-ray crystallography

    • Apply cryo-electron microscopy for membrane-embedded structural analysis

  • Interaction studies:

    • Investigate direct binding to pro-sigma E using pull-down assays

    • Perform co-immunoprecipitation to identify protein interaction partners

    • Use bacterial two-hybrid systems to map interaction domains

How can researchers distinguish between direct and indirect effects of spoIIGA manipulation on solventogenesis?

Distinguishing direct from indirect effects of spoIIGA manipulation requires careful experimental design. Research on spoIIE in C. acetobutylicum provides a valuable methodological framework:

  • Timing analysis: spoIIE expression occurred significantly after solventogenesis had commenced

  • Enzyme activity measurements: No significant difference in CoAT (CoA transferase) activity was observed between wild-type and spoIIE-downregulated strains

  • Phenotypic analysis: Sporulation blockage at stage II kept cells in a solventogenic state for longer periods

For spoIIGA research, similar approaches should be employed:

  • Temporal analysis:

    • Precisely determine when spoIIGA is expressed relative to solventogenesis onset

    • Monitor metabolic shifts in wild-type and spoIIGA-manipulated strains

  • Enzymatic assessment:

    • Measure activities of key solventogenic enzymes (CoAT, alcohol/aldehyde dehydrogenases)

    • Perform transcriptional analysis of solventogenic genes

  • Genetic dissection:

    • Create double mutants (e.g., spoIIGA with key solventogenic genes)

    • Test whether solventogenic phenotypes are epistatic to sporulation phenotypes

  • Metabolic flux analysis:

    • Track carbon flow through central metabolism and solventogenic pathways

    • Identify metabolic bottlenecks that may be indirectly affected by sporulation defects

What are the evolutionary implications of differences in SpoIIGA function between Clostridium and Bacillus species?

The divergence in sporulation regulatory networks between Clostridium and Bacillus species has significant evolutionary implications. While the search results don't directly address SpoIIGA evolution, they do highlight important differences in the sporulation cascade:

  • In C. acetobutylicum, sigma K acts both early and late in sporulation, unlike in B. subtilis where it functions only late

  • The phenotypic consequences of sigE disruption differ between B. subtilis and C. acetobutylicum

  • The relationship between sporulation and solventogenesis appears to be genetically separable in C. acetobutylicum but integrated in a different manner than in B. subtilis

These observations suggest potential research directions for investigating SpoIIGA evolution:

  • Comparative genomics:

    • Analyze sequence conservation of spoIIGA across diverse spore-forming bacteria

    • Identify co-evolving gene pairs (e.g., spoIIGA and spoIIGB/sigE)

    • Reconstruct the evolutionary history of the sporulation cascade

  • Functional complementation:

    • Test whether SpoIIGA from one species can complement defects in another

    • Identify species-specific interacting partners

    • Create chimeric proteins to map functionally divergent domains

  • Ecological context analysis:

    • Correlate SpoIIGA sequence/function variations with ecological niches

    • Investigate selection pressures on sporulation vs. solventogenesis in different environments

What are the key considerations for expressing and purifying recombinant SpoIIGA for in vitro studies?

Successful expression and purification of membrane proteins like SpoIIGA presents significant challenges. Based on established methodologies for similar proteins, researchers should consider:

  • Expression system selection:

    • E. coli-based systems with specialized strains (C41/C43, Lemo21) designed for membrane protein expression

    • Cell-free expression systems that can accommodate detergent micelles or lipid nanodiscs

    • Homologous expression in Clostridium if heterologous systems fail

  • Fusion tag strategies:

    • N-terminal tags that don't interfere with membrane insertion

    • Cleavable tags (TEV, PreScission protease sites)

    • Solubility-enhancing partners (MBP, SUMO) for improved expression

  • Membrane extraction and stabilization:

    • Screening multiple detergents (DDM, LDAO, Triton X-100) for efficient extraction

    • Reconstitution into nanodiscs or liposomes for functional studies

    • Amphipol stabilization for structural studies

  • Activity preservation:

    • Develop functional assays to monitor SpoIIGA activity during purification

    • Include appropriate cofactors and stabilizers in purification buffers

    • Consider co-expression with interacting partners (e.g., pro-sigma E)

How can researchers effectively study SpoIIGA-substrate interactions?

Investigating how SpoIIGA interacts with and processes its substrate (pro-sigma E) requires specialized approaches:

  • In vitro processing assays:

    • Express and purify pro-sigma E as a substrate

    • Develop fluorogenic peptide substrates based on the cleavage site

    • Monitor processing kinetics under various conditions

  • Binding studies:

    • Surface plasmon resonance (SPR) for measuring binding kinetics

    • Microscale thermophoresis for detecting interactions in solution

    • Crosslinking coupled with mass spectrometry to map interaction interfaces

  • Structural analysis of the complex:

    • Co-crystallization attempts of SpoIIGA with substrate peptides

    • Hydrogen-deuterium exchange mass spectrometry to map binding interfaces

    • Computational docking validated by mutagenesis

  • Cellular localization of interactions:

    • Fluorescence resonance energy transfer (FRET) between tagged proteins

    • Split fluorescent protein complementation assays

    • Co-localization studies using fluorescence microscopy

What emerging technologies could advance the study of SpoIIGA function and regulation?

Several cutting-edge technologies show promise for deeper investigation of SpoIIGA:

  • CRISPR-Cas9 genome editing in Clostridium:

    • Precise introduction of point mutations to test functional hypotheses

    • Creation of fluorescent protein fusions at endogenous loci

    • Conditional degradation systems for temporal control of SpoIIGA levels

  • Cryo-electron tomography:

    • Visualizing SpoIIGA in its native membrane environment

    • Capturing structural transitions during sporulation

    • Mapping spatial organization of the sporulation machinery

  • Single-cell analyses:

    • Time-lapse fluorescence microscopy to track SpoIIGA dynamics

    • Single-cell RNA-seq to capture transcriptional heterogeneity in sporulating populations

    • Microfluidics to control microenvironments and observe decision-making in sporulation

  • Synthetic biology approaches:

    • Reconstitution of minimal sporulation systems in heterologous hosts

    • Design of synthetic regulatory circuits to control SpoIIGA activity

    • Creation of orthogonal systems to test evolutionary hypotheses

How can systems biology approaches enhance our understanding of SpoIIGA's role in the sporulation network?

Systems biology offers powerful frameworks for understanding SpoIIGA within the broader sporulation network:

  • Network modeling:

    • Construct mathematical models of the sporulation decision network

    • Perform sensitivity analysis to identify key regulatory points

    • Predict system behavior under perturbations

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data from sporulating cultures

    • Map temporal progression of regulatory events

    • Identify feedback and feedforward loops involving SpoIIGA

  • Comparative systems analysis:

    • Analyze differences in network architecture between Clostridium and Bacillus

    • Identify conserved motifs versus species-specific adaptations

    • Relate network structures to ecological strategies

  • Machine learning approaches:

    • Train algorithms to predict sporulation outcomes from multi-factorial inputs

    • Identify non-obvious correlations in large datasets

    • Optimize experimental design for maximum information gain

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.