Recombinant Clostridium acetobutylicum Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Clostridium acetobutylicum Prolipoprotein Diacylglyceryl Transferase (Lgt)

Recombinant Clostridium acetobutylicum prolipoprotein diacylglyceryl transferase (Lgt) is a bioengineered enzyme derived from the anaerobic, solventogenic bacterium C. acetobutylicum. This enzyme catalyzes the critical first step in bacterial lipoprotein maturation by transferring an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine residue of prolipoproteins, enabling proper membrane anchoring and protein stability . Recombinant production typically involves heterologous expression in E. coli with tags (e.g., His-tag) for purification .

Gene and Protein Attributes

FeatureDescriptionSource
Gene locusPart of the lgt-thyA operon, encoding thymidylate synthase (thyA) downstream
Protein length272 amino acids (aa) for C. acetobutylicum (Uniprot: Q97M68)
Key residuesHis-103 (active site), Tyr-235, His-196 (catalytic function)
Membrane localizationInner membrane protein, essential for bacterial viability

The enzyme’s catalytic mechanism involves a thioester intermediate, where the diacylglyceryl group is transiently linked to a conserved cysteine residue .

Recombinant Expression Systems

Host OrganismTag TypeExpression RegionApplicationSource
E. coliN-terminal His-tag1–272 aaPurification, biochemical assays
E. coliUntaggedFull-lengthStructural studies (e.g., X-ray crystallography)

Key Production Details:

  • Purification: Affinity chromatography using nickel columns for His-tagged variants .

  • Storage: Tris-based buffer with 50% glycerol at -20°C to -80°C .

  • Stability: Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for ≤1 week .

Functional Roles in C. acetobutylicum

  1. Membrane Protein Modification:

    • Lgt is essential for lipoprotein maturation, influencing membrane integrity and stress responses .

    • Inactivation disrupts cell viability, as lipoproteins are critical for nutrient transport and membrane structure .

  2. Biomass Tolerance Engineering:

    • Overexpression of lgt (with thyA) enhances tolerance to toxic aldehydes (e.g., furfural) in industrial fermentations. This operon modulates lipid composition and DNA synthesis, mitigating solvent toxicity .

  3. Metabolic Engineering Insights:

    • In C. acetobutylicum, lgt is co-expressed with thyA (thymidylate synthase), linking membrane lipid metabolism to nucleotide biosynthesis. Mutations in lgt reduce butanol and acetone yields, highlighting its role in solventogenesis .

Biotechnological Applications

  • Industrial Biocatalysis: Engineered lgt variants optimize membrane protein stability in recombinant strains for biofuel production .

  • Vaccine Development: Recombinant Lgt serves as an antigen for studying Clostridium pathogenesis, though C. acetobutylicum is nonpathogenic .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your specification.
Synonyms
lgt; CA_C0330; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)
Target Names
lgt
Target Protein Sequence
MILLYLHIYEQKGSGTLNPVAFTLFGLEIRWYGILIATGVILGLFMAYSNSKLREIEYDS VLDIILISLPIGIIGARLYYVIFQFKSYNGNIIDMINIRNGGLAIHGGLIFGCLAAYIYS RYKKLSFLKLMDIAAPSIILAQALGRWGNFFNGEAHGGPVTYSFIEKFPKFIQKGMTIDG MYYNPTFLYESTWDFVTFIILMLLIRKCKNKGVVFFGYVGLYSLGRFFIEGMRTDSLMLG PIRVAQLVSILGMLISLGFITFSYVKTKRISK
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the first step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Prolipoprotein diacylglyceryl transferase (lgt) in C. acetobutylicum?

Prolipoprotein diacylglyceryl transferase (lgt) in C. acetobutylicum is the first enzyme in the bacterial lipoprotein modification pathway. It catalyzes the attachment of a diacylglyceryl group from phosphatidylglycerol to the thiol of the cysteine residue, which is typically the first amino acid after the signal peptide in bacterial prolipoproteins . This post-translational modification is essential for anchoring hydrophilic proteins to bacterial membranes, enabling them to perform various functions critical for the bacterium, including pathogenesis in some species.

How is lgt genetically encoded in C. acetobutylicum?

In C. acetobutylicum ATCC 824/DSM 792, the lgt gene is designated as CA_C0330 in the ordered locus . The lgt protein sequence consists of 272 amino acids and belongs to a highly conserved family of enzymes found across bacterial species. Unlike some genes in C. acetobutylicum that appear in clusters (like orfA, sigE, and sigG), lgt stands as an independent genetic unit with its own promoter and regulatory elements .

What is the relationship between lgt and membrane biology in C. acetobutylicum?

Lgt functions at the interface of protein secretion and membrane biology in C. acetobutylicum. As the enzyme responsible for the initial step in lipoprotein modification, it plays a crucial role in the proper localization of membrane-associated proteins. The diacylglyceryl modification creates a hydrophobic anchor that embeds proteins into the bacterial membrane. This is particularly important for C. acetobutylicum as a Gram-positive bacterium with a complex cell envelope structure featuring characteristic endospores with a distinct bowling pin or bottle shape . The proper functioning of membrane-associated proteins is essential for various cellular processes, including solvent production, sporulation, and biofilm formation .

Expression and Purification Methods

Purifying recombinant lgt while maintaining its activity requires careful consideration of its membrane-associated nature. The following stepwise purification strategy has proven effective:

  • Cell lysis: Gentle disruption using detergent-based methods rather than sonication helps preserve the native structure.

  • Detergent selection: Mild non-ionic detergents (e.g., n-dodecyl-β-D-maltoside) at concentrations just above CMC (critical micelle concentration) effectively solubilize the membrane-associated lgt.

  • Chromatography sequence:

    • Initial capture: Immobilized metal affinity chromatography (IMAC) if His-tagged

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

  • Buffer optimization: Maintaining pH 7.0-7.5 with glycerol (10%) and reducing agents helps preserve activity.

  • Activity preservation: Addition of phospholipids during purification can help maintain the enzyme in its active conformation.

The purification process should be monitored through SDS-PAGE and Western blotting, with activity assays performed at each step to ensure retention of enzymatic function .

How does lgt activity impact C. acetobutylicum solvent production pathways?

Lgt activity indirectly influences C. acetobutylicum solvent production by affecting the localization and function of membrane-associated proteins involved in solventogenesis. Research has demonstrated complex interactions between membrane biology and metabolic pathways:

  • Membrane integrity effects: Proper lipoprotein modification by lgt maintains membrane integrity, which is crucial during solventogenesis when butanol accumulation stresses cell membranes. Strains with enhanced solvent production (like PJC4BK) have been shown to overcome the 180 mM butanol toxicity limit, suggesting adaptations in membrane composition and protein localization .

  • Metabolic enzyme localization: Several key enzymes in the solventogenic pathway have been found in biofilm extracellular matrix, including electron transfer flavoprotein (EtfAB), crotonase (Crt), acetoacetyl-CoA:acetate/butyrate CoA-transferase (CtfAB), and alcohol dehydrogenase E (adhE) . The proper modification and anchoring of these enzymes by lgt may influence their activity and localization.

  • Signaling pathway impacts: Lgt-modified proteins play roles in sensing environmental conditions that trigger the shift from acidogenesis to solventogenesis. The metabolic shift in recombinant strains shows altered flux patterns, with increases in acetate formation fluxes of up to 100% during early growth and mean specific butanol and ethanol formation fluxes increasing significantly .

Experimental evidence suggests that manipulating lgt expression could be a strategy for enhancing solvent production, though direct causative relationships need further investigation.

What analytical methods best characterize the enzymatic activity of purified recombinant lgt?

Characterizing the enzymatic activity of purified recombinant lgt requires specialized analytical approaches due to its membrane-associated nature and specific substrate requirements:

  • Radiolabeled substrate assay: The gold standard involves using 3H or 14C-labeled phosphatidylglycerol as substrate and monitoring the transfer of radiolabeled diacylglyceryl groups to a synthetic prolipoprotein substrate.

  • HPLC-MS/MS analysis: A non-radioactive alternative utilizing HPLC separation coupled with tandem mass spectrometry to detect and quantify modified prolipoprotein substrates.

  • Fluorescence-based assays: Utilizing synthetic peptide substrates containing environmentally sensitive fluorophores that change quantum yield upon diacylglyceryl modification.

  • Coupled enzyme assays: Measuring activity indirectly by coupling lgt reaction to subsequent enzymatic steps and monitoring changes in absorbance.

To ensure physiological relevance, these assays should be performed at pH ≥ 5.0, reflecting the optimal conditions for C. acetobutylicum growth and metabolism during the acidogenic-solventogenic transition .

How does recombinant lgt compare structurally and functionally to lgt from other bacterial species?

Comparative analysis of C. acetobutylicum lgt with homologs from other bacterial species reveals both conserved features and unique characteristics:

FeatureC. acetobutylicum lgtOther Bacterial lgtSignificance
Domain architectureConserved membrane-spanning regionsSimilar in most bacteriaEssential for substrate recognition
Active siteHighly conserved aspartic acid residueUniversal among lgt enzymesCritical for catalytic function
Substrate specificityMay have unique lipobox recognitionVaries between speciesCould influence which proteins are modified
Membrane topologyMultiple transmembrane domainsSimilar in most bacteriaDetermines enzyme orientation relative to substrates
Regulatory mechanismsMay respond to solventogenic signalsVaries by speciesPotentially unique to C. acetobutylicum physiology

The crystal structure analysis methodology used for other C. acetobutylicum proteins (as seen with CA_C0359 ) could be applied to lgt, using molecular replacement techniques with previously solved bacterial lgt structures as templates. This would provide valuable insights into the specific structural features that might influence its function in the unique metabolic context of C. acetobutylicum .

What are the most effective genetic tools for manipulating lgt expression in C. acetobutylicum?

Several genetic tools have proven effective for manipulating lgt expression in C. acetobutylicum:

  • ClosTron® technology: This insertional mutagenesis system enables targeted gene knockouts and has been successfully used for creating various C. acetobutylicum mutants, including those affecting cell morphology genes . For lgt studies, ClosTron insertion can create a complete knockout to study loss-of-function effects.

  • Allele-coupled exchange (ACE): This homologous recombination-based system allows marker-less gene deletion or modification and has been used to create multiple auxotrophic strains in C. acetobutylicum with high efficiency . For lgt studies, ACE can create precise modifications to lgt promoter regions or coding sequences.

  • Plasmid-based expression systems: Several shuttle vectors exist for C. acetobutylicum, including pIA derivatives that allow for controlled overexpression of target genes . For lgt studies, these systems enable complementation of mutants or controlled overexpression.

  • Antisense RNA technology: This approach uses complementary RNA to downregulate gene expression and has been effective in modulating expression of various genes in C. acetobutylicum, such as ctfB . For lgt studies, antisense RNA can create partial knockdowns to study dose-dependent effects.

  • Orthogonal sigma factor-based expression control: The TcdR system from C. difficile has been adapted for C. acetobutylicum, allowing for inducible gene expression when placed under the control of the tcdB promoter . This system would enable tight control over lgt expression timing.

When implementing these tools, dual antibiotic selection has been validated in C. acetobutylicum, allowing for more complex genetic manipulations, as demonstrated in strain PJC4BK(pTAAD) .

How can researchers develop C. acetobutylicum strains with modified lgt to enhance specific properties?

Developing C. acetobutylicum strains with modified lgt requires a strategic approach:

  • Define target phenotype: Determine specific improvements sought (e.g., increased solvent production, stress tolerance, substrate utilization).

  • Design modification strategy:

    • For enhanced activity: Overexpression using strong promoters (e.g., thl promoter used successfully for other genes)

    • For altered specificity: Site-directed mutagenesis of active site residues

    • For controlled expression: Inducible systems like the lactose-inducible bgaR::PbgaL system

  • Vector construction and methylation:

    • Construct appropriate vectors (e.g., pSYL2 derivatives)

    • Methylate using E. coli ER2275 (pAN1) to prevent restriction

  • Transformation optimization:

    • Use electroporation for C. acetobutylicum (typical yields of 1.0-2.0 × 10¹ transformants)

    • Culture in anaerobic conditions at 37°C

    • Select with appropriate antibiotics (erythromycin at 100 μg/mL in liquid media and 40 μg/mL in solid media)

  • Phenotypic validation:

    • Analyze membrane lipoproteome changes (proteomics)

    • Assess solvent production profiles and stress tolerance

    • Evaluate growth characteristics and metabolic flux changes

The integration of lgt modifications at the pyrE locus has been shown to be particularly effective for stable expression, as demonstrated with other genes in C. acetobutylicum .

What unexpected phenotypes might emerge from lgt-modified C. acetobutylicum strains?

Altering lgt expression in C. acetobutylicum can lead to several unexpected phenotypes due to its fundamental role in membrane biology:

  • Altered sporulation efficiency: Modified lipoprotein anchoring may affect sporulation signaling pathways. Previous research has shown that biofilm formation in C. acetobutylicum leads to downregulation of sporulation genes, including those encoding the sporulation regulator σK (sigK, CA_C1689) and spore coat synthesis proteins . Lgt modifications might similarly disrupt sporulation timing or efficiency.

  • Changes in biofilm formation capacity: Lipoproteins are key components of biofilm matrices. Transcriptomic and proteomic analyses of C. acetobutylicum biofilms have revealed significant changes in extracellular matrix composition and metabolism . Lgt modifications could enhance or diminish biofilm formation abilities.

  • Unexpected substrate utilization patterns: C. acetobutylicum biofilm cells show enhanced ability to utilize xylose, with 70% improvement in xylose utilization from glucose-xylose mixtures . Modified lgt expression might similarly alter carbon source preferences by changing membrane transporter localization.

  • Altered stress responses: Properly modified lipoproteins may contribute to stress resistance. Since solvent-producing Clostridium strains face severe challenges from butanol toxicity, lgt modifications might unexpectedly enhance or reduce tolerance to solvents or other stressors.

  • Changes in acid/solvent ratio: The shift from acidogenesis to solventogenesis might be affected by membrane composition changes. Research with recombinant C. acetobutylicum has shown that overexpression of certain genes can increase acid or solvent production significantly, as seen with ptb/buk or aad gene modifications .

These potential phenotypes should be systematically assessed through metabolomics, transcriptomics, and detailed physiology studies when characterizing new lgt-modified strains.

What are the optimal fermentation conditions for studying lgt-modified C. acetobutylicum strains?

Optimizing fermentation conditions is crucial for properly evaluating the phenotypes of lgt-modified strains:

ParameterOptimal ConditionRationaleReference
pH≥ 5.0 controlledCrucial for solvent production; pH ≥ 5.0 fermentations have shown enhanced solvent production in engineered strains
Temperature37°CStandard growth temperature for C. acetobutylicum
Anaerobic conditionsStrict anaerobiosisEssential for proper metabolism in this obligate anaerobe
Media compositionCGM with 80 g/L glucoseSupports robust growth and solvent production
Inoculum preparationHeat shock at 70-80°C for 10 minEnhances solvent production and prevents strain degeneration
Fermentation formatBioreactor with 4.0 L working volumesAllows proper pH control and sampling
Inoculum volume10% (v/v) pre-culture with A600 = 0.2Ensures consistent lag phase

When studying gene expression effects specifically, researchers should consider implementing controlled induction systems, such as the lactose-inducible bgaR::PbgaL system that has been successfully used to regulate gene expression in C. acetobutylicum . For strains carrying plasmids, appropriate antibiotics must be maintained throughout the fermentation to ensure plasmid retention.

How can researchers troubleshoot common issues with recombinant lgt expression and activity?

When working with recombinant lgt from C. acetobutylicum, researchers may encounter several challenges that can be addressed with specific troubleshooting approaches:

  • Low expression levels:

    • Issue: Poor protein production in heterologous hosts

    • Solution: Optimize codon usage for the expression host; use strong, inducible promoters; consider fusion tags to enhance stability

    • Validation: Compare expression levels by Western blot analysis using anti-lgt antibodies or tag-specific antibodies

  • Inclusion body formation:

    • Issue: Insoluble protein aggregates when expressed in E. coli

    • Solution: Lower induction temperature (16-25°C); co-express with chaperones; use solubility tags; consider membrane-fraction purification

    • Validation: Compare soluble vs. insoluble fractions by SDS-PAGE and activity assays

  • Loss of enzymatic activity:

    • Issue: Purified protein shows low or no activity

    • Solution: Add phospholipids during purification; maintain reducing conditions; avoid freeze-thaw cycles

    • Validation: Compare activity under various buffer conditions using standard assays

  • Plasmid instability in C. acetobutylicum:

    • Issue: Loss of plasmid during fermentation

    • Solution: Maintain antibiotic selection; use chromosomal integration for stable expression; consider dual antibiotic selection as used with strain PJC4BK(pTAAD)

    • Validation: PCR verification of plasmid presence throughout fermentation; monitor reporter gene expression if applicable

  • Unexpected phenotypes in modified strains:

    • Issue: Strain behavior differs from predicted outcomes

    • Solution: Conduct comprehensive phenotypic analysis including transcriptomics and metabolomics; consider compensatory mutations

    • Validation: Compare multiple independent transformants; conduct complementation studies

The experimental validation of lgt function can be challenging due to its membrane-associated nature, but careful optimization of expression and purification conditions can yield active enzyme for in vitro studies .

What advanced analytical techniques can assess the impact of lgt modifications on C. acetobutylicum membrane composition?

Assessing the impact of lgt modifications on C. acetobutylicum membrane composition requires sophisticated analytical approaches:

  • Lipidomics analysis:

    • LC-MS/MS profiling: Provides comprehensive analysis of membrane lipid composition changes

    • GC-FID analysis: Quantifies fatty acid composition changes in membrane phospholipids

    • 31P-NMR spectroscopy: Identifies changes in phospholipid head group distribution

  • Membrane proteomics:

    • Membrane fractionation with differential centrifugation: Isolates membrane proteins

    • Hydrophobic interaction chromatography: Enriches membrane proteins

    • TMT or iTRAQ labeling: Enables quantitative comparison between wild-type and modified strains

    • Targeted proteomics (PRM/MRM): Precisely quantifies specific lipoproteins of interest

  • Structural assessment:

    • Freeze-fracture electron microscopy: Visualizes membrane architecture changes

    • Atomic force microscopy: Measures membrane physical properties at nanoscale

    • Fluorescence anisotropy: Evaluates membrane fluidity alterations

  • Functional characterization:

    • Membrane permeability assays: Measures integrity changes using fluorescent dyes

    • Surface plasmon resonance: Analyzes protein-membrane interactions

    • Metabolic flux analysis: Identifies changes in metabolism due to altered membrane composition, as demonstrated with recombinant strains showing decreased butyrate formation fluxes by up to 75% and increased acetate formation fluxes of up to 100%

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.