Recombinant Clostridium acetobutylicum Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Clostridium acetobutylicum Protein CrcB Homolog 1 (crcB1) is a genetically engineered protein expressed in microbial systems for research and industrial applications. It is a homolog of the putative fluoride ion transporter CrcB, initially identified in Mycobacterium paratuberculosis . This protein plays a potential role in microbial stress response and ion transport, though its exact biological mechanisms in C. acetobutylicum remain under investigation.

4.1. Genetic and Proteomic Insights

  • Homolog Identification: crcB1 shares functional domains with fluoride transporters in other bacteria, implying conserved ion transport mechanisms .

  • Stress Response: Proteins like crcB1 are hypothesized to enhance bacterial survival under metabolite stress (e.g., butanol toxicity) . For example, disrupting genes linked to stress tolerance in C. acetobutylicum alters solvent production and cellular motility .

4.2. Metabolic Engineering Applications

While crcB1 itself has not been directly engineered, studies on C. acetobutylicum highlight the importance of transporter proteins in improving solvent yields:

  • Butanol Tolerance: Overexpression of stress-related proteins (e.g., alcohol dehydrogenases) enhances butanol production by 200–300% .

  • CRISPR/Cas9 Tools: Advanced genetic tools enable precise modifications in C. acetobutylicum, potentially applicable to crcB1 for optimizing ion transport .

Applications and Future Directions

  • Bioremediation: Potential use in fluoride detoxification systems.

  • Biofuel Production: Engineering crcB1 could improve C. acetobutylicum’s tolerance to solvents like butanol, boosting biofuel yields .

  • Vaccine Development: Recombinant crcB1 is listed as a candidate antigen for Clostridium-targeted vaccines .

Challenges and Knowledge Gaps

  • Functional Validation: The exact role of crcB1 in fluoride transport or solventogenesis requires enzymatic assays and gene knockout studies.

  • Industrial Scalability: Stability of the recombinant protein under fermentation conditions remains untested .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with blue ice packs by default. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB1; CA_C1586; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)
Target Names
crcB1
Target Protein Sequence
MKKYILIGLGGAIGAILRCFIRNTKIPVYKGEFPISTLMINLSGAFILAVILITANEIWS FNEEIRLGIATGFVGAYTTFSTMCKETIILMNKNLYFLAFCYVTVSVVFGLLFAYFGALS ARKILSRLLKVRKEDEKAS
Uniprot No.

Target Background

Function
Essential for reducing intracellular fluoride concentration and its associated toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of crcB1 in Clostridium acetobutylicum ATCC 824?

The crcB1 gene in C. acetobutylicum ATCC 824 should be analyzed within the broader genomic context established through the available genome sequence. C. acetobutylicum ATCC 824 serves as a model organism for clostridial metabolism and has a fully sequenced genome that enables genomic context analysis . When examining crcB1, researchers should investigate neighboring genes, potential operons, and regulatory elements to understand its genetic organization. Unlike many other bacterial species, C. acetobutylicum has several distinct metabolic programs regulated by cascading sigma factors, which could influence crcB1 expression . Detailed genomic analysis using bioinformatics tools to identify promoter regions, transcription factor binding sites, and terminator sequences should be conducted to fully characterize the genomic environment.

How does crcB1 relate to the broader metabolic network of C. acetobutylicum?

To understand crcB1's role in C. acetobutylicum's metabolism, researchers should integrate it into the established genome-scale metabolic model. C. acetobutylicum's metabolism includes specialized pathways for solventogenesis and acidogenesis, with significant regulatory changes occurring during different growth phases . The relationship between crcB1 and these metabolic shifts should be systematically investigated through growth experiments under different conditions.

Metabolic network analysis approaches include:

ApproachDescriptionApplication to crcB1 research
Flux Balance AnalysisMathematical approach using genome-scale modelsPredict metabolic impacts of crcB1 perturbation
TranscriptomicsGene expression profiling across conditionsIdentify co-regulated genes and expression patterns
MetabolomicsComprehensive metabolite measurementsDetect metabolic changes in crcB1 mutants

Integration of crcB1 into comprehensive models, similar to those developed for other C. acetobutylicum genes, will provide insights into its systemic role in cellular metabolism .

What bioinformatic approaches should be used to identify conserved domains in CrcB1?

Researchers should employ multiple complementary bioinformatic tools to comprehensively analyze CrcB1's conserved domains. Start with sequence alignment tools (BLAST, HMMER) to identify homologous proteins across bacterial species, followed by specialized domain prediction tools (InterPro, Pfam, SMART) to identify conserved functional domains.

For structural predictions, researchers should consider:

  • Primary sequence analysis to identify conserved residues

  • Secondary structure prediction using tools like PSIPRED

  • Tertiary structure modeling through homology modeling approaches

When analyzing predicted structures, researchers should compare them to known protein structures in the PDB database, similar to the approach used for the CA_C0359 protein in C. acetobutylicum . This protein was analyzed by comparing its structure to YteR from Bacillus subtilis, revealing a six-α-hairpin barrel with conserved active sites despite low primary sequence identity . For CrcB1, similar comparative approaches would be valuable in predicting functional domains and potential active sites.

How can the crystal structure of CrcB1 from C. acetobutylicum be determined and what structural insights might it provide?

Determining the crystal structure of CrcB1 requires a systematic experimental approach similar to that used for other C. acetobutylicum proteins. Based on the successful crystallization of the CA_C0359 protein , researchers should:

  • Express recombinant CrcB1 in an appropriate host system (E. coli BL21 is commonly used)

  • Purify using affinity chromatography followed by size exclusion chromatography

  • Screen multiple crystallization conditions (pH, temperature, precipitants)

  • Collect X-ray diffraction data and solve the structure using molecular replacement if homologous structures exist

The study of CA_C0359 protein from C. acetobutylicum demonstrated that structures can be solved to high resolution (1.6 Å) using molecular replacement techniques, even when the protein has low primary sequence identity to its structural homologs . For CrcB1, structural analysis would likely reveal important functional elements such as transmembrane domains (if present) and potential ion binding sites, given its predicted role in fluoride transport.

Expected structural insights include:

  • Identification of conserved residues forming the ion channel or pore

  • Comparison with CrcB proteins from other bacterial species

  • Electrostatic surface potential mapping to understand ion selectivity

  • Structural basis for potential regulatory mechanisms

What experimental approaches would best characterize the regulatory relationship between CcpA and crcB1 expression in C. acetobutylicum?

To investigate whether Catabolite Control Protein A (CcpA) regulates crcB1 expression, researchers should employ multiple complementary approaches:

TechniqueImplementationExpected Outcome
Electrophoretic Mobility Shift Assay (EMSA)Incubate purified CcpA with labeled crcB1 promoter fragmentsDetect direct binding interactions
DNase I footprintingIdentify specific nucleotides protected by CcpA bindingMap precise binding sites at nucleotide resolution
Reporter gene assaysFuse crcB1 promoter to reporter gene, test in wild-type and ccpA mutantQuantify regulatory effects
RT-qPCRCompare crcB1 expression in wild-type and ccpA mutant strainsMeasure regulatory impact on native gene expression
  • Chromatin immunoprecipitation (ChIP) using CcpA-specific antibodies to identify in vivo binding to the crcB1 promoter.

This multi-faceted approach would establish whether crcB1 belongs to the CcpA regulon, which is known to control various metabolic functions in C. acetobutylicum including carbon source utilization and solventogenesis .

How can CRISPR-Cas9 techniques be optimized for creating precise crcB1 mutants in C. acetobutylicum?

Developing an optimized CRISPR-Cas9 system for C. acetobutylicum crcB1 mutagenesis requires addressing several technical challenges specific to Clostridium species:

  • Vector design considerations:

    • Use replicative plasmids suitable for C. acetobutylicum

    • Include appropriate selection markers (typically erythromycin resistance)

    • Optimize codon usage for Cas9 expression in Clostridium

  • sgRNA design strategies:

    • Select targets with minimal off-target effects in the C. acetobutylicum genome

    • Focus on critical functional domains identified through bioinformatic analysis

    • Target regions that allow distinction between crcB1 and potential paralogs

  • DNA repair template design:

    • For precise mutations, include ~1kb homology arms flanking the mutation site

    • Consider incorporating silent mutations in the PAM site to prevent re-cutting

    • Include suitable markers for selection or screening

  • Transformation protocol optimization:

    • Use electroporation protocols specifically adapted for C. acetobutylicum

    • Perform transformations in an anaerobic chamber to maintain strict anaerobic conditions

    • Optimize recovery media composition to enhance transformation efficiency

Testing multiple gRNA target sites and verifying mutants through sequencing is critical, as is phenotypic characterization to confirm functional changes. This approach would be similar to the successful generation of the butyrate kinase (buk) inactivation mutant in C. acetobutylicum, which demonstrated significant metabolic changes .

What expression systems are most effective for producing recombinant CrcB1 protein from C. acetobutylicum?

Selecting an optimal expression system for CrcB1 requires careful consideration of protein characteristics and experimental goals:

Expression SystemAdvantagesLimitationsBest For
E. coli BL21(DE3)High yield, simple protocolsMay not properly fold membrane proteinsInitial structural studies, antibody production
C. acetobutylicum native expressionNative folding and modificationsLower yield, more complex protocolsFunctional studies requiring authentic protein
Cell-free systemsRapid, works with toxic proteinsHigher cost, potentially lower yieldPreliminary functional screening

Key optimization parameters include:

  • Induction conditions (temperature, inducer concentration, duration)

  • Media composition and growth conditions

  • Codon optimization for the chosen expression host

  • Fusion tags to enhance solubility and purification

How should researchers design experiments to investigate CrcB1's role in fluoride resistance in C. acetobutylicum?

To systematically investigate CrcB1's role in fluoride resistance, researchers should employ a multi-faceted experimental approach:

  • Generate and validate genetic variants:

    • Create a clean crcB1 deletion mutant

    • Develop a complemented strain expressing crcB1 from a controlled promoter

    • Engineer point mutations in conserved residues to identify essential domains

  • Design comprehensive phenotypic assays:

    • Growth curve analysis in media with varying fluoride concentrations (0-100 mM)

    • Measurement of intracellular fluoride concentrations using fluoride-selective electrodes

    • Membrane permeability assays to assess general membrane integrity

  • Implement control experiments:

    • Test resistance to other halides (chloride, bromide) as specificity controls

    • Examine growth under other stress conditions to determine stress response specificity

    • Analyze potential compensatory mechanisms (e.g., expression of other transporters)

  • Quantitative measurements should include:

    • Determination of minimal inhibitory concentration (MIC) for fluoride

    • Kinetics of fluoride uptake/efflux in different strains

    • Gene expression changes in response to fluoride exposure

This approach would be analogous to studies of other C. acetobutylicum genes where genetic modifications have been characterized through detailed phenotypic analysis, as demonstrated with the butyrate kinase inactivation mutant .

How can isothermal titration calorimetry (ITC) be optimized to study CrcB1's ion binding properties?

Optimizing ITC experiments for CrcB1 requires careful consideration of protein stability, buffer conditions, and experimental parameters:

  • Protein preparation considerations:

    • Purify CrcB1 to >95% homogeneity using multiple chromatography steps

    • Verify protein stability in the selected buffer through dynamic light scattering

    • Determine protein concentration accurately using amino acid analysis

    • Remove any bound ions through dialysis against chelating agents

  • Buffer optimization parameters:

    • Match buffer composition precisely between protein and ion solutions

    • Consider pH effects on binding (typically test range pH 6.0-8.0)

    • Optimize ionic strength to minimize non-specific interactions

    • Include appropriate detergents if working with the membrane-embedded form

  • Experimental design considerations:

    • Titrate fluoride and other halide ions to determine binding specificity

    • Test binding at physiologically relevant temperatures (30-37°C)

    • Evaluate potential cooperativity through careful data analysis

    • Design control experiments with mutated variants to confirm binding sites

ITC data analysis should fit appropriate binding models (one-site, sequential binding, etc.) and report thermodynamic parameters (Kd, ΔH, ΔS, ΔG) for comprehensive characterization of ion binding properties. This approach would provide quantitative insights into CrcB1's ion selectivity and binding mechanism.

How should researchers interpret transcriptomic data to understand crcB1 regulation in different growth phases of C. acetobutylicum?

Interpreting transcriptomic data for crcB1 requires integration with the known metabolic phases of C. acetobutylicum:

  • Data preprocessing and normalization:

    • Apply robust normalization methods suitable for time-series data

    • Account for batch effects across experiments

    • Validate expression patterns through RT-qPCR of selected genes

  • Co-expression analysis strategies:

    • Cluster genes with similar expression profiles to identify regulatory modules

    • Compare crcB1 expression with known phase-specific genes (e.g., sol operon genes)

    • Identify potential regulators through correlation analysis

  • Integration with metabolic phases:

    • Map expression patterns to acidogenic and solventogenic phases

    • Compare with expression patterns of CcpA-regulated genes

    • Analyze correlation with sporulation-specific genes

C. acetobutylicum undergoes distinct metabolic phases including acidogenesis, solventogenesis, and sporulation, each with characteristic gene expression patterns . Researchers should interpret crcB1 expression data in this context, noting whether it correlates with genes involved in specific metabolic programs. The CcpA regulon provides an important reference point, as it controls both carbon metabolism and solventogenesis in C. acetobutylicum .

Growth PhaseMetabolic CharacteristicsKey Reference GenesAnalysis Focus
AcidogenesisAcid production, rapid growthptb, bukEarly growth phase expression
SolventogenesisSolvent production, slower growthadhE1, ctfA, ctfBTransition phase regulation
SporulationEndospore formationspo0A, sigE, sigFLate phase expression

What are the key considerations when analyzing protein-protein interaction data for CrcB1 in C. acetobutylicum?

When analyzing protein-protein interaction (PPI) data for CrcB1, researchers should consider:

  • Technical validation approaches:

    • Confirm interactions using orthogonal methods (e.g., co-IP following Y2H)

    • Validate expression of fusion proteins/constructs

    • Assess non-specific interactions through appropriate controls

  • Biological context considerations:

    • Determine if interactions occur in relevant cellular compartments

    • Consider temporal aspects (growth phase-dependent interactions)

    • Evaluate if membrane localization may affect interaction detection

  • Network analysis strategies:

    • Build interaction networks integrating both direct and indirect interactions

    • Analyze network topology to identify potential functional modules

    • Compare with known protein complexes in C. acetobutylicum or related organisms

  • Functional interpretation:

    • Group interacting proteins by functional categories

    • Correlate with gene expression data across growth conditions

    • Identify potential regulatory relationships

For membrane proteins like CrcB1, special consideration should be given to detection methods compatible with membrane localization, such as membrane yeast two-hybrid or proximity labeling approaches. Interpretation should consider the known metabolic network of C. acetobutylicum and potential involvement in specific cellular processes like ion homeostasis or stress response.

How can genomic data from multiple Clostridium species be used to understand the evolution and function of CrcB1?

Comparative genomic analysis of CrcB homologs across Clostridium species provides valuable evolutionary and functional insights:

  • Sequence-based evolutionary analysis:

    • Construct multiple sequence alignments of CrcB homologs

    • Build phylogenetic trees to visualize evolutionary relationships

    • Calculate selective pressure (dN/dS ratios) to identify conserved functional regions

  • Genomic context analysis:

    • Examine conservation of neighboring genes (synteny analysis)

    • Identify potential operonic structures across species

    • Analyze promoter regions for conserved regulatory elements

  • Structure-function relationship:

    • Map conserved residues onto predicted structural models

    • Identify species-specific variations in functional domains

    • Correlate structural predictions with known phenotypic differences

  • Integration with environmental adaptations:

    • Correlate CrcB variations with species habitat characteristics

    • Compare CrcB features between pathogenic and non-pathogenic Clostridia

    • Analyze correlation with fluoride levels in natural habitats

This approach would be similar to comparative studies of other Clostridium proteins, such as the comparison between C. acetobutylicum CA_C0359 and B. subtilis YteR , which revealed structural conservation despite sequence divergence. For CrcB1, comparative analysis would help distinguish core functional elements from species-specific adaptations.

How can metabolic flux analysis be applied to understand the impact of crcB1 mutations on C. acetobutylicum metabolism?

Metabolic flux analysis (MFA) can provide quantitative insights into how crcB1 mutations impact C. acetobutylicum metabolism:

  • Experimental design considerations:

    • Compare wild-type, crcB1 deletion, and complemented strains

    • Perform experiments under defined media conditions with controlled carbon sources

    • Include isotopic labeling (typically 13C-glucose) for flux determination

  • Analytical approaches:

    • Measure extracellular metabolite concentrations over time

    • Determine isotopomer distributions using GC-MS or LC-MS/MS

    • Apply computational models to estimate intracellular fluxes

  • Integration with genome-scale models:

    • Incorporate crcB1 function into existing C. acetobutylicum metabolic models

    • Simulate metabolic impacts of crcB1 disruption

    • Compare experimental data with model predictions to refine understanding

  • Key flux measurements should include:

    • Central carbon metabolism pathways

    • Acid and solvent production pathways

    • Energy generation processes

This approach has been successfully applied to characterize metabolic changes in C. acetobutylicum mutants, including the butyrate kinase inactivation mutant . For crcB1, MFA would help determine whether fluoride transport impacts specific metabolic pathways, potentially through effects on fluoride-sensitive enzymes.

What systems biology approaches can integrate transcriptomic, proteomic, and metabolomic data to understand CrcB1's role in C. acetobutylicum?

A comprehensive systems biology approach would integrate multiple data types to provide a holistic view of CrcB1 function:

  • Multi-omics data generation:

    • Perform RNA-Seq under various conditions (different growth phases, fluoride stress)

    • Conduct quantitative proteomics on the same samples

    • Measure intracellular and extracellular metabolites

  • Integrative analysis methods:

    • Apply correlation networks to identify relationships across data types

    • Implement multi-block statistical methods (DIABLO, MOFA)

    • Use genome-scale models as a scaffold for data integration

  • Visualization and interpretation tools:

    • Map data onto metabolic pathways using tools like KEGG or BioCyc

    • Create custom visualizations highlighting CrcB1-affected processes

    • Develop dynamic models capturing temporal aspects of responses

  • Validation approaches:

    • Test predictions through targeted genetic manipulations

    • Verify key findings using independent experimental methods

    • Compare results with known regulatory relationships in C. acetobutylicum

Similar approaches have been used to characterize the CcpA regulon in C. acetobutylicum, integrating transcriptomic data with phenotypic characterization and motif analysis . For CrcB1, systems biology would help position its function within the broader cellular context, potentially revealing unexpected connections to metabolic or regulatory networks.

How should researchers design synthetic biology approaches to engineer CrcB1 for enhanced fluoride resistance in industrial C. acetobutylicum strains?

Engineering enhanced fluoride resistance through CrcB1 modifications requires a systematic synthetic biology approach:

  • Design principles for CrcB1 engineering:

    • Analyze natural variants with enhanced fluoride resistance

    • Use structural modeling to identify critical residues for mutagenesis

    • Design libraries targeting channel selectivity and transport efficiency

  • Expression optimization strategies:

    • Test promoters with different strength and regulatory characteristics

    • Optimize ribosome binding sites for translation efficiency

    • Consider genomic integration versus plasmid-based expression

  • Screening and selection methods:

    • Develop high-throughput fluoride resistance assays

    • Implement FACS-based screening using fluoride-responsive reporters

    • Design selection schemes in fluoride-containing media

  • Integration with industrial strain development:

    • Combine with other beneficial traits (solvent tolerance, substrate utilization)

    • Assess metabolic burden of engineered constructs

    • Evaluate stability over extended cultivation periods

This approach would build upon established genetic modification techniques for C. acetobutylicum, such as those used to create the butyrate kinase inactivation mutant , while incorporating modern synthetic biology principles. The goal would be to develop strains with enhanced resistance to fluoride contamination that might be present in industrial feedstocks.

What are the most promising research directions for understanding CrcB1's role in C. acetobutylicum stress response?

Future research on CrcB1 should focus on:

  • Comprehensive characterization of CrcB1's role in multiple stress responses beyond fluoride resistance

  • Integration of CrcB1 function with known stress response pathways in C. acetobutylicum

  • Structural and biophysical studies to elucidate the ion transport mechanism

  • Investigation of potential regulatory interactions with global regulators like CcpA

These directions would provide a deeper understanding of how CrcB1 contributes to C. acetobutylicum's remarkable ability to adapt to diverse environmental conditions, potentially informing strategies for engineering more robust industrial strains.

How can CrcB1 research contribute to improving industrial biobutanol production using C. acetobutylicum?

CrcB1 research has several potential applications for industrial biobutanol production:

  • Development of strains with enhanced tolerance to fluoride and potentially other stressors present in industrial feedstocks

  • Integration with existing strain improvement efforts, such as those focusing on the butyrate pathway

  • Application of systems biology approaches to understand how ion homeostasis affects solvent production

  • Creation of biosensors based on CrcB1 for monitoring toxic ion levels in industrial processes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.