Recombinant Clostridium acetobutylicum Putative zinc metalloprotease CA_C1796 (CA_C1796)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Clostridium acetobutylicum Putative zinc metalloprotease CA_C1796

Recombinant Clostridium acetobutylicum Putative zinc metalloprotease CA_C1796 is a protein encoded by the CA_C1796 gene in Clostridium acetobutylicum. This protein is classified as a putative zinc metalloprotease, indicating that while its structure suggests metalloprotease activity, its specific enzymatic functions may not be fully characterized experimentally . The protein has been identified in protein databases with the UniProt ID Q97I57 and consists of 339 amino acids spanning the full length of the native protein .

The term "recombinant" indicates that this protein is produced through heterologous expression systems, typically using Escherichia coli as the host organism for large-scale production. The recombinant form of the protein is often modified with specific tags, such as an N-terminal histidine tag, to facilitate purification and downstream applications . This approach enables researchers to obtain purified CA_C1796 protein for structural studies, enzymatic characterizations, and various biotechnological applications.

Expression and Production Methods

The production of Recombinant Clostridium acetobutylicum Putative zinc metalloprotease CA_C1796 employs established molecular biology techniques to ensure high yield and purity. The expression methodology is critical for obtaining functionally active protein suitable for research applications.

Expression System

The recombinant CA_C1796 protein is typically produced using E. coli as the expression host, which provides several advantages including rapid growth, high protein yields, and well-established genetic manipulation protocols . The bacterial expression system allows for scalable production and relatively straightforward purification procedures.

Production Process

The production workflow for recombinant CA_C1796 typically includes:

  1. Gene cloning into an appropriate expression vector

  2. Transformation of the recombinant construct into competent E. coli cells

  3. Culture of transformed cells under optimized conditions

  4. Induction of protein expression

  5. Cell harvesting and lysis

  6. Protein purification, often utilizing the N-terminal His-tag for affinity chromatography

  7. Quality control testing including purity assessment via SDS-PAGE

  8. Lyophilization to generate the final product format

The expression of full-length CA_C1796 (amino acids 1-339) with an N-terminal His-tag facilitates downstream purification while maintaining the protein's native sequence integrity .

Reconstitution Protocol

For optimal reconstitution of lyophilized CA_C1796:

  1. Centrifuge the vial briefly before opening to collect all material at the bottom

  2. Reconstitute in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to 5-50% final concentration for cryoprotection

  4. Divide into small working aliquots to minimize freeze-thaw cycles

  5. Store reconstituted aliquots at -20°C/-80°C for long-term storage or at 4°C for short-term use

Proper adherence to these storage and handling guidelines ensures the stability and functional integrity of the recombinant protein for experimental applications.

Biological Context of Clostridium acetobutylicum

Understanding the biological context of Clostridium acetobutylicum provides valuable insights into the potential functions of CA_C1796 within its native environment.

Organism Background

Clostridium acetobutylicum is a strictly anaerobic, Gram-positive bacterium renowned for its ability to ferment starchy materials to produce acetone, butanol, and ethanol through the acetone-butanol-ethanol (ABE) fermentation process . This metabolic capability has made C. acetobutylicum an organism of significant industrial interest for biofuel and biochemical production.

Metabolic Phases

C. acetobutylicum exhibits a biphasic fermentation process that is highly dependent on environmental pH:

  1. Acidogenesis (pH > 5.2): During this phase, the bacterium predominantly produces organic acids, specifically acetate and butyrate

  2. Solventogenesis (pH < 5.1): As the pH decreases, metabolism shifts toward the production of solvents, particularly acetone and butanol

  3. Transition phase (5.1 < pH < 5.2): An intermediate state characterized by changes in gene expression and metabolic activity

This pH-dependent metabolic shift is accompanied by comprehensive changes in the transcriptome, proteome, and metabolome, indicating complex regulatory mechanisms . While the specific role of CA_C1796 in these processes is not explicitly described in the available literature, metalloproteases often participate in protein turnover, regulatory processes, and adaptation to environmental changes.

Potential Functions and Applications

Although the specific biological role of CA_C1796 is not extensively characterized in the available literature, its classification as a putative zinc metalloprotease suggests several potential functions and applications.

Predicted Enzymatic Functions

As a putative zinc metalloprotease, CA_C1796 likely catalyzes the hydrolysis of peptide bonds in target proteins or peptides. Zinc metalloproteases typically contain a conserved metal-binding domain where zinc ions are coordinated by amino acid residues, enabling the catalytic mechanism. These enzymes often show substrate specificity, targeting particular amino acid sequences or structural motifs.

Potential Biological Roles

In the context of C. acetobutylicum metabolism, CA_C1796 may participate in:

  1. Protein turnover and homeostasis within the bacterial cell

  2. Processing of regulatory proteins involved in metabolic transitions

  3. Degradation of extracellular proteins for nutrient acquisition

  4. Adaptation to environmental stresses, including pH changes during the shift from acidogenesis to solventogenesis

  5. Potential involvement in cell wall or membrane remodeling during growth and division

Research Applications

The recombinant form of CA_C1796 provides valuable opportunities for:

  1. Structural studies to determine three-dimensional conformation and active site architecture

  2. Enzymatic characterization to confirm protease activity and define substrate specificity

  3. Development of specific inhibitors for mechanistic studies

  4. Investigation of protein-protein interactions within C. acetobutylicum

  5. Comparative studies with metalloproteases from other Clostridium species

Research Challenges and Future Directions

The study of Recombinant Clostridium acetobutylicum Putative zinc metalloprotease CA_C1796 presents several challenges and opportunities for future research.

Current Research Limitations

Research on CA_C1796 faces several challenges:

  1. Limited available information on its specific physiological function

  2. The "putative" designation indicates predictions based on sequence homology rather than experimental validation

  3. Challenges in maintaining enzymatic activity during purification and storage

  4. Limited structural data on the three-dimensional conformation and active site

Future Research Opportunities

Promising directions for future research include:

  1. Crystallographic or cryo-EM studies to determine the protein's structure

  2. Enzymatic assays to identify natural substrates and catalytic parameters

  3. Gene knockout or mutation studies in C. acetobutylicum to assess physiological roles

  4. Investigation of CA_C1796 regulation during the acidogenesis-solventogenesis transition

  5. Exploration of potential biotechnological applications in protein engineering or industrial processes

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format we have in stock, we are open to fulfilling specific format requests. Please indicate any preferred format requirements during order placement, and we will accommodate your needs to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. We recommend reaching out to your local distributor for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, and customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag during production.
Synonyms
CA_C1796; Putative zinc metalloprotease CA_C1796
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)
Target Names
CA_C1796
Target Protein Sequence
MSFFNIVIAILAFGVLILIHELGHFVLAKLNDVKVEEFAIGMGPKLLGIKGKETQYSIRA LPIGGYVKMLGDESKSDDPRAFNNKSSARRLSIVIAGPIMNLILAAVLFCIVGMSEGIAL PTVGKISANSPAQKIGIKAGDTIVKINNYSVHTWEDISFNMALNKGEGIKLALKNNGTIK KVTLVPQYSKKEKMYLIGISPKFIDKPTIIEGAKYGTSETVTMIKTVYLSLKMMVTGKAS AKDVSGPVSIIKVTGAAANAGFIRLVNFIAFISAQLGVMNLLPIPALDGGFVFLFLFQMI TGKKVDDDKVGFVNTIGFALLMILMIVVTIKDVVYPINF
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M50B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant CA_C1796 protein samples?

The recombinant CA_C1796 protein should be stored at -20°C/-80°C upon receipt, with aliquoting recommended for multiple use scenarios to avoid degradation from repeated freeze-thaw cycles. For short-term storage of working solutions, samples can be kept at 4°C for up to one week .

The lyophilized protein is typically stored in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0. For reconstitution, it is recommended to centrifuge the vial briefly before opening and then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol (final concentration) is advisable for long-term storage, with 50% being the standard recommendation .

What is the recommended protocol for expressing recombinant CA_C1796 in E. coli?

While specific optimization for CA_C1796 expression must be empirically determined for each laboratory setup, the general protocol for expressing this metalloprotease builds on established methods for recombinant Clostridium proteins:

  • Vector Selection: Use pET-based vectors with an N-terminal His-tag for efficient purification

  • Host Strain: BL21(DE3) or Rosetta(DE3) strains are recommended for optimal expression

  • Induction Conditions:

    • Culture bacteria at 37°C until OD600 reaches 0.6-0.8

    • Reduce temperature to 18-25°C

    • Induce with 0.1-0.5 mM IPTG

    • Continue expression for 16-20 hours

  • Harvesting: Centrifuge culture at 4,000g for 20 minutes at 4°C

  • Lysis Buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM PMSF, 1 mg/mL lysozyme

  • Purification: Ni-NTA affinity chromatography followed by size exclusion chromatography

Verification of protein purity should be performed using SDS-PAGE, with expected purity greater than 90% .

How can researchers effectively assess the enzymatic activity of recombinant CA_C1796?

Since CA_C1796 is a putative zinc metalloprotease, enzymatic activity assessment should employ standard protease activity assays with modifications specific to metalloproteases:

  • Substrate Selection: Use fluorogenic peptide substrates containing FRET pairs or chromogenic substrates specific for metalloproteases.

  • Assay Buffer Composition:

    • 50 mM Tris-HCl, pH 7.5

    • 150 mM NaCl

    • 5 mM CaCl₂

    • 1 μM ZnCl₂

    • 0.05% Brij-35

  • Control Inhibitors:

    • Include EDTA (5-10 mM) as a negative control (should inhibit activity)

    • Include specific metalloprotease inhibitors to confirm specificity

  • Assay Conditions:

    • Temperature: 30-37°C

    • pH range: 6.0-8.0 (test multiple values to determine optimum)

    • Incubation time: 30 minutes to 2 hours

  • Detection Methods:

    • Fluorescence spectroscopy for FRET-based substrates

    • Absorption spectroscopy for chromogenic substrates

    • SDS-PAGE analysis of protein substrate degradation

Researchers should note that as a putative metalloprotease, functional confirmation is an essential step in characterization, and negative results should prompt investigation of assay conditions or substrate selection rather than immediate dismissal of protease activity.

How does CA_C1796 relate to essential gene networks in Clostridium acetobutylicum?

Recent transposon insertion site sequencing studies in Clostridium acetobutylicum have identified a core group of 418 essential genes needed for in vitro development . While specific data regarding CA_C1796's essentiality is not directly provided in the search results, researchers can integrate this protein into the broader context of C. acetobutylicum's gene essentiality networks.

When designing knockout experiments or gene silencing approaches for CA_C1796, researchers should consider:

  • Growth Media Supplementation: If the gene is potentially essential, culture media may need supplementation with specific metabolites to compensate for the loss of function.

  • Conditional Knockout Strategies: Employing inducible promoters or CRISPRi systems rather than complete gene deletion can help determine if the gene is conditionally essential.

  • Synthetic Lethality Analysis: Investigating genetic interactions with known pathways can reveal functional redundancy or synthetic lethal relationships.

The comprehensive gene essentiality data provided by recent studies serves as a valuable resource for contextualizing the role of CA_C1796 within the organism's broader metabolic and cellular functions .

What is known about the potential role of CA_C1796 in C. acetobutylicum metabolism and solventogenesis?

While direct experimental evidence for CA_C1796's specific role in metabolism is limited in the search results, we can contextualize its potential function within C. acetobutylicum's well-studied metabolic framework:

C. acetobutylicum is primarily known for its ability to produce solvents (acetone, butanol, and ethanol) through a biphasic fermentation process. As a putative zinc metalloprotease, CA_C1796 may be involved in:

  • Protein Turnover: Metalloproteases often participate in protein quality control and turnover of misfolded proteins, which is particularly important during stress conditions such as solventogenesis.

  • Regulatory Cascade Involvement: It may process inactive precursors of regulatory proteins that control metabolic shifts between acidogenesis and solventogenesis.

  • Cell Envelope Maintenance: Given its predicted membrane association (based on the amino acid sequence containing transmembrane regions), it could play a role in cell envelope remodeling during environmental adaptations.

Recent metabolic engineering studies in C. acetobutylicum have focused on enhancing butyric acid production through targeted gene knockouts of pathways including pta, buk, ctfB, adhE1, and hydA . Future research could investigate how CA_C1796 interacts with or influences these pathways, potentially offering new targets for metabolic engineering.

What approaches can be used to investigate the substrate specificity of CA_C1796?

Determining the substrate specificity of CA_C1796 requires a multi-faceted approach:

  • Proteomics-Based Methods:

    • TAILS (Terminal Amine Isotopic Labeling of Substrates)

    • COFRADIC (Combined Fractional Diagonal Chromatography)

    • PICS (Proteomic Identification of Cleavage Sites)

  • Peptide Library Screening:

    • Positional scanning synthetic combinatorial libraries

    • Multiplex substrate profiling by mass spectrometry (MSP-MS)

  • Computational Prediction:

    • Homology modeling based on related zinc metalloproteases

    • Molecular docking with potential substrate peptides

    • Sequence alignment with characterized metalloproteases

  • Targeted Validation:

    • Design peptides based on predicted cleavage sites

    • Validate with LC-MS/MS analysis of cleavage products

    • Quantify kinetic parameters (kcat, KM) for validated substrates

The substrate specificity data can then be used to infer the biological function of CA_C1796 and its potential regulatory roles in C. acetobutylicum metabolism.

How might recombinant CA_C1796 be utilized in biotechnology applications?

Based on C. acetobutylicum's importance in biotechnology, CA_C1796 might have several potential applications:

  • Biocatalysis:

    • If substrate specificity reveals unique cleavage patterns, CA_C1796 could be developed as a novel biocatalyst for peptide modification or specialized proteolysis.

  • Metabolic Engineering Tool:

    • As C. acetobutylicum is increasingly used for sustainable production of chemicals, understanding CA_C1796's role could inform genetic engineering strategies.

    • Recent studies highlighting the importance of gene essentiality analysis provide context for how CA_C1796 manipulation might affect production strains .

  • Biosensor Development:

    • If CA_C1796 responds to specific environmental conditions or metabolites, it could be engineered as a biosensing element.

  • Structural Biology Research:

    • The availability of recombinant CA_C1796 enables structural studies that could reveal novel catalytic mechanisms or structural features of bacterial metalloproteases.

When considering these applications, researchers should carefully evaluate CA_C1796's stability, activity parameters, and potential for scale-up, while remaining focused on its fundamental biochemical properties rather than premature commercialization.

What are common challenges in purifying active recombinant CA_C1796 and how can they be addressed?

Researchers frequently encounter several challenges when purifying metalloproteases like CA_C1796:

  • Inclusion Body Formation:

    • Challenge: Overexpression often leads to inclusion bodies

    • Solution: Reduce expression temperature to 16-18°C, lower IPTG concentration (0.1 mM), or use solubility-enhancing fusion tags like SUMO or MBP

  • Metal Ion Depletion:

    • Challenge: Loss of zinc during purification leading to inactive enzyme

    • Solution: Supplement buffers with 1-10 μM ZnCl₂ throughout purification process

  • Auto-proteolysis:

    • Challenge: Self-degradation during expression or storage

    • Solution: Add protease inhibitors (except metalloprotease inhibitors), reduce purification temperature to 4°C, and process samples quickly

  • Protein Aggregation:

    • Challenge: Aggregation after refolding or during concentration

    • Solution: Include 5-10% glycerol or 0.05% detergent (non-ionic) in buffers; concentrate to ≤1 mg/mL

  • Activity Loss During Storage:

    • Challenge: Gradual activity decrease during storage

    • Solution: Store at -80°C with 50% glycerol; avoid repeated freeze-thaw cycles

How can researchers validate that recombinant CA_C1796 maintains native-like structure and function?

Confirming that recombinant CA_C1796 reflects the native protein's properties requires multiple validation approaches:

  • Structural Validation:

    • Circular Dichroism (CD): Compare secondary structure profiles with predicted models

    • Thermal Shift Assays: Assess protein stability and proper folding

    • Size-Exclusion Chromatography: Verify proper oligomeric state

  • Functional Validation:

    • Metal Content Analysis: ICP-MS to confirm zinc incorporation at expected stoichiometry

    • Activity Comparison: If possible, compare with native protein extracted from C. acetobutylicum

    • pH and Temperature Optima: Verify these match predicted physiological conditions

  • Complementation Studies:

    • Express recombinant CA_C1796 in a knockout strain to verify functional restoration

    • Use site-directed mutagenesis to confirm catalytic residues

  • Proteomic Validation:

    • Mass spectrometry to confirm post-translational modifications match native protein

    • Limited proteolysis experiments to assess domain structure integrity

How does CA_C1796 fit into the context of recent gene essentiality studies in C. acetobutylicum?

Recent transposon insertion site sequencing studies have identified 418 essential genes in C. acetobutylicum required for in vitro development . This research provides a framework for understanding the potential criticality of CA_C1796:

  • Essentiality Classification:

    • Researchers should consult the comprehensive gene list from recent studies to determine if CA_C1796 is among the 418 essential genes

    • If essential, genetic manipulation strategies should employ conditional systems rather than direct knockouts

    • If non-essential, researchers can explore knockout phenotypes to determine functional roles

  • Functional Context:

    • Essential metalloproteases often participate in critical cellular processes such as:

      • Cell division protein processing

      • Stress response pathway activation

      • Signal peptide processing

      • Cell envelope maintenance

  • Genetic Neighborhood Analysis:

    • Examining genes in proximity to CA_C1796 on the chromosome and assessing their essentiality status

    • Investigating potential operonic structures or functional relationships with nearby genes

  • Comparative Genomics Approach:

    • Comparing CA_C1796 conservation across Clostridium species and correlating with essentiality data

    • Identifying functionally characterized homologs in model organisms

This integration with essentiality data provides researchers with critical context for designing experiments and interpreting results related to CA_C1796 function .

What is the relationship between CA_C1796 and metabolic engineering efforts in C. acetobutylicum?

Metabolic engineering of C. acetobutylicum has focused on enhancing butyric acid production and other valuable compounds through genetic manipulation . Understanding CA_C1796's role in this context requires considering:

  • Potential Regulatory Functions:

    • As a putative metalloprotease, CA_C1796 may process or degrade regulatory proteins involved in solventogenesis

    • It could influence metabolic shifts between acidogenesis and solventogenesis phases

  • Integration with Engineered Pathways:

    • Recent successful engineering strategies have involved disrupting genes like pta, buk, ctfB, adhE1, and hydA

    • CA_C1796 manipulation could potentially complement these modifications by:

      • Altering protein turnover in key metabolic pathways

      • Modifying cell envelope properties to enhance solvent tolerance

      • Processing precursors of regulatory proteins

  • Stress Response Mediation:

    • Solvent production induces stress responses in C. acetobutylicum

    • Metalloproteases often function in stress response pathways, suggesting CA_C1796 might influence cellular adaptation to solventogenesis

  • Experimental Approaches:

    • Transcriptomic analysis comparing CA_C1796 expression across fermentation phases

    • Proteomics studies to identify proteins processed by CA_C1796 during metabolic shifts

    • Testing CA_C1796 overexpression or regulated expression in engineered production strains

Understanding these relationships could potentially reveal new targets for metabolic engineering and improve production of valuable compounds like butyric acid, which has been enhanced to 32.5 g/L with a butyric-to-acetic acid ratio of 31.3 g/g in engineered strains .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.