Recombinant Clostridium acetobutylicum UPF0059 membrane protein CA_C0950 (CA_C0950)

Shipped with Ice Packs
In Stock

Description

Overview

The Recombinant Clostridium acetobutylicum UPF0059 membrane protein CA_C0950 (CA_C0950) is a bioengineered protein derived from the industrially significant bacterium C. acetobutylicum (strain ATCC 824). It belongs to the UPF0059 family of proteins, which are uncharacterized in terms of function but annotated as membrane-associated based on sequence analysis . This protein is commercially available as a recombinant product, purified for research or industrial applications.

Research Context and Relevance

CA_C0950 is part of a broader category of C. acetobutylicum membrane proteins critical for industrial biotechnology. While not directly studied in published literature, insights into related membrane proteins highlight their roles in:

  • Transport and Metabolism: Membrane proteins in C. acetobutylicum facilitate substrate uptake, solvent production (e.g., butanol, acetone), and energy metabolism .

  • Stress Response: Mutant strains with altered membrane proteomes show enhanced tolerance to solvents like butanol , suggesting membrane proteins may modulate stress adaptation.

  • Biofilm Formation: Membrane-associated proteins contribute to extracellular polysaccharide synthesis and biofilm stability, though CA_C0950’s role here is unexplored .

Amino Acid Sequence Analysis

The complete sequence of CA_C0950 is provided below, segmented for clarity:

N-Terminal Segment (1–50):
MNIYSLFVVAIALSLDAFGVALSIGLDSCVKRKNKLLFAISFGFFQFLCTFIGAYSGFLF

Middle Segment (51–100):
NTYITYVPQIIGGMIIAFVGAFMIKEGFDNKEEKLLLNFKMYFVLGISVSIDAAVVGFTM

C-Terminal Segment (101–183):
FNKISSNYVILGDSVFIGIVTLILSIIAFIISRYLKRIQLVCKYADYIGGIILVIFGLKM
MMFF

This sequence includes regions with predicted transmembrane domains (e.g., LIRKLGIAICFLMLIPNEIYI), consistent with membrane localization .

Gaps and Future Directions

While CA_C0950 is commercially available, no peer-reviewed studies explicitly investigate its biochemical function. Key research gaps include:

  • Functional Characterization: Role in transport, signaling, or stress response.

  • Interaction Networks: Potential binding partners or regulatory pathways.

  • Industrial Applications: Suitability for biofilm engineering or solvent production optimization.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, and additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; CA_C0950; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)
Target Names
mntP
Target Protein Sequence
MNIYSLFVVAIALSLDAFGVALSIGLDSCVKRKNKLLFAISFGFFQFLCTFIGAYSGFLF NTYITYVPQIIGGMIIAFVGAFMIKEGFDNKEEKLLLNFKMYFVLGISVSIDAAVVGFTM FNKISSNYVILGDSVFIGIVTLILSIIAFIISRYLKRIQLVCKYADYIGGIILVIFGLKM MFF
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of CA_C0950 in Clostridium acetobutylicum?

The CA_C0950 protein is a membrane protein encoded by the genome of Clostridium acetobutylicum, a bacterium well-known for its industrial applications in solvent production, particularly acetone, butanol, and ethanol. Membrane proteins like CA_C0950 play critical roles in cellular processes such as transport, signaling, and maintaining structural integrity. In the context of C. acetobutylicum, CA_C0950 may be involved in metabolic pathways that influence solventogenesis or sporulation. Sporulation is a survival mechanism under nutrient-limited conditions, and its regulation often involves membrane-associated proteins . Understanding the function of CA_C0950 could provide insights into optimizing fermentation processes or engineering strains with enhanced solvent production capabilities.

How can recombinant expression systems be used to study CA_C0950?

Recombinant expression systems are essential tools for studying membrane proteins like CA_C0950 due to their hydrophobic nature and low native abundance. To express CA_C0950 recombinantly, researchers typically use bacterial systems such as Escherichia coli or eukaryotic systems like yeast or mammalian cells. These systems allow for controlled expression and facilitate purification processes. Techniques such as codon optimization and fusion tags (e.g., His-tag or FLAG-tag) are often employed to enhance protein yield and simplify purification . Once expressed, solubilization strategies using detergents or novel amphipathic proteins (e.g., WRAPs) can stabilize the protein for structural and functional studies .

How can CRISPR-Cas9 or other gene-editing tools be applied to study CA_C0950?

Gene-editing tools such as CRISPR-Cas9 enable precise manipulation of genetic sequences to investigate the role of specific genes like CA_C0950 in cellular processes. By creating knockout or knock-in mutants of C. acetobutylicum, researchers can assess phenotypic changes resulting from altered expression of CA_C0950. For example, CRISPR-Cas9-mediated deletion of CA_C0950 could reveal its impact on solvent production or stress responses under anaerobic conditions . Complementary techniques like RNA sequencing can further elucidate downstream effects on gene regulatory networks.

What experimental approaches can be used to characterize the structure-function relationship of CA_C0950?

Characterizing the structure-function relationship of membrane proteins requires integrating biochemical, biophysical, and computational methods:

  • X-ray Crystallography: This technique provides high-resolution structural data but often requires crystallization trials with detergents or lipid mimetics.

  • Cryo-Electron Microscopy (Cryo-EM): Cryo-EM has emerged as a powerful tool for studying membrane proteins without the need for crystallization.

  • Circular Dichroism (CD) Spectroscopy: CD spectroscopy assesses secondary structure content and folding stability.

  • Molecular Dynamics Simulations: Computational simulations predict conformational dynamics and interactions within lipid bilayers .

  • Functional Assays: Enzymatic activity assays or ligand-binding studies validate structural findings by linking them to biological functions.

How can discrepancies in experimental data regarding CA_C0950 be resolved?

Discrepancies in experimental data often arise from differences in methodologies, sample preparation, or environmental conditions during experiments. Resolving these contradictions requires:

  • Standardization: Ensuring consistent protocols across experiments.

  • Replication: Conducting independent replicates to verify results.

  • Cross-validation: Using complementary techniques (e.g., combining Cryo-EM with X-ray crystallography).

  • Meta-analysis: Pooling data from multiple studies to identify trends or outliers .
    For example, if conflicting results emerge about CA_C0950's role in sporulation versus solventogenesis, transcriptomic and proteomic analyses could clarify its regulatory functions under varying growth conditions.

What role does CA_C0950 play in sporulation and granulose accumulation?

Sporulation is a complex process regulated by environmental cues such as nutrient availability and stress conditions. Granulose accumulation often precedes sporulation in C. acetobutylicum as an energy reserve mechanism . Proteins like CA_C0950 may act as sensors or mediators within signaling pathways that trigger sporulation. Experimental approaches such as gene knockouts combined with metabolite profiling can elucidate its involvement in these processes.

How can metabolic engineering strategies leverage knowledge about CA_C0950?

Metabolic engineering aims to optimize microbial pathways for industrial applications such as biofuel production. Insights into CA_C0950's function could inform strategies to enhance butanol yields by redirecting metabolic fluxes or improving stress tolerance during fermentation . Techniques include overexpressing CA_C0950 in engineered strains or modulating its activity through small-molecule inhibitors.

What methods are available for quantifying the expression levels of recombinant CA_C0950?

Quantifying protein expression levels is crucial for assessing experimental success and optimizing conditions:

  • Western Blotting: Detects specific proteins using antibodies.

  • Enzyme-Linked Immunosorbent Assay (ELISA): Provides quantitative measurements.

  • Mass Spectrometry: Offers precise quantification based on peptide identification.

  • Fluorescence-Based Assays: Utilize fluorescent tags for real-time monitoring .

How can data visualization enhance understanding of research findings related to CA_C0950?

Effective data visualization highlights trends and patterns that might otherwise remain obscure in raw datasets:

  • Tables synthesize numerical data for quick reference .

  • Graphs illustrate relationships between variables (e.g., expression levels vs solvent yields).

  • Structural models generated from Cryo-EM or molecular dynamics simulations provide visual insights into protein-lipid interactions.

By adhering to best practices in table design—such as clear titles and descriptive column headings—researchers can ensure their findings are accessible and interpretable .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.