Recombinant Clostridium beijerinckii Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Cobalamin Synthase (CobS): Functional Overview

CobS is a critical enzyme in cobalamin biosynthesis, responsible for attaching the nucleotide loop to the corrin ring during the final assembly of adenosylcobalamin (vitamin B<sub>12</sub>) . In aerobic organisms like Pseudomonas denitrificans, CobS operates late in the pathway after cobalt insertion, whereas anaerobic pathways (e.g., in Salmonella) incorporate cobalt early .

Key catalytic roles of CobS:

  • Amidation of cobyrinic acid to form cobyric acid.

  • Ligand coordination of cobalt with adenosyl groups.

  • Nucleotide loop assembly for coenzyme functionality .

Cobalamin Biosynthesis in Recombinant C. beijerinckii

Transcriptomic studies of the engineered strain C. beijerinckii_mgsA+mgR revealed:

FeatureDifferential ExpressionFunctional ImplicationSource
Vitamin B<sub>12</sub> biosynthesis genesUpregulatedEnhanced cobalamin production for redox balance
Fe-S cluster proteinsDownregulatedReduced reliance on Fe-S-dependent pathways
Tryptophan biosynthesisUpregulatedAlternative NAD biosynthesis via quinolinate

This strain exhibited 87% higher butanol titers on lactose, linked to metabolic shifts favoring NADH re-oxidation and redox cofactor optimization . Though cobS is not explicitly named in the datasets, the upregulation of cobalamin pathway genes suggests CobS-like activity supports these adaptations.

Genomic Context of C. beijerinckii Cobalamin Pathways

Comparative genomics of C. beijerinckii strains highlights:

  • Open pangenome with 1,567 core genes and extensive accessory genomes, enabling metabolic flexibility .

  • Mobile genetic elements: 15 transposase and 12 phage integrase families, indicating horizontal gene transfer potential for pathway optimization .

  • Anaerobic cobalt insertion: Likely follows early cobalt chelation, as seen in Salmonella and Propionibacterium .

Industrial Applications and Challenges

Engineered C. beijerinckii strains convert lactose-rich whey permeate into butanol efficiently, with transcriptomic data suggesting:

  • Iron limitation resilience: Downregulation of Fe-S proteins reduces metal dependency .

  • NAD pool remodeling: Shift from L-aspartate to tryptophan-derived biosynthesis improves solventogenesis .

Outstanding questions:

  • Does C. beijerinckii utilize a cobS-orthologous gene for B<sub>12</sub> assembly?

  • How do cobalt uptake systems (e.g., cbiMNQO) interact with solvent production?

Future Directions

Targeted studies are needed to:

  1. Annotate cobS homologs in C. beijerinckii genomes.

  2. Characterize cobalt transport kinetics in recombinant strains.

  3. Optimize B<sub>12</sub>-dependent pathways for scalable bio-butanol production.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cobS; Cbei_1265; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) (Clostridium acetobutylicum)
Target Names
cobS
Target Protein Sequence
MKKLYKGFIMALSMFTILPTPYVEWDDDGVKNMMKFYPLIGLIIGVLWSIIYYLASILNA SIILKSSIITIVPFIITGMLHLDGFMDVCDAILSRRSKEEKLRILKDSATGAFAVIPLVI LFFLQFGGVYSILEKNSSLYTLILIPIISRSVVAYYLLSRATIKESTLGTYFKKGTNVYD KLIMIITLIITLIISVILLNIYGIILVLLMSLGIKLSVEKCRKEFGGISGDVAGFALVIG EVVGILILGIIP
Uniprot No.

Target Background

Function

This recombinant Clostridium beijerinckii Cobalamin synthase (CobS) catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin) from adenosylcobinamide-GDP and α-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.

Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (cobS) in Clostridium beijerinckii and what is its biochemical role?

Cobalamin synthase (cobS) is an essential enzyme in the vitamin B12 (cobalamin) biosynthetic pathway of Clostridium beijerinckii. This enzyme catalyzes one of the final steps in assembling the corrin ring structure that forms the core of the cobalamin molecule. Specifically, cobS is responsible for incorporating the cobalt ion into the tetrapyrrole structure and facilitating subsequent modifications.

Clostridium beijerinckii is particularly valuable for studying this enzyme as it is a non-pathogenic bacterial species capable of producing various industrially relevant compounds, including solvents and organic acids . The functioning cobS enzyme contributes to the metabolic versatility of this organism by enabling vitamin B12 synthesis, which serves as a cofactor for various enzymatic reactions.

How does C. beijerinckii cobS compare structurally with cobS enzymes from other bacterial species?

While the complete crystallographic structure of C. beijerinckii cobS has not been fully characterized in the provided literature, several comparative insights can be drawn. The enzyme belongs to the broader family of ATP:corrinoid adenosyltransferases that participate in B12 metabolism. According to product information, the C. beijerinckii cobS (UniProt ID: A6LSW5) is specific to the strain ATCC 51743/NCIMB 8052 .

The structural uniqueness of C. beijerinckii cobS likely relates to adaptations for functioning in the strictly anaerobic environment required by this organism. Unlike cobS enzymes from facultative anaerobes, the C. beijerinckii variant would be expected to have structural features optimized for oxygen-free conditions that characterize its native cellular environment.

What expression systems are most suitable for producing recombinant C. beijerinckii cobS?

Based on current research protocols, yeast expression systems have proven effective for producing recombinant C. beijerinckii cobS with high purity (>85% as assessed by SDS-PAGE) . The selection of yeast as an expression host likely addresses several technical challenges:

  • The complex protein folding requirements of cobS can be better accommodated in eukaryotic expression systems

  • Post-translational modifications may be more appropriately processed in yeast compared to bacterial systems

  • Potential toxicity issues that might occur in E. coli expression are mitigated

When designing expression constructs, researchers should consider codon optimization for the selected host organism and appropriate fusion tags to facilitate downstream purification while minimizing impact on enzymatic activity.

What are optimal storage conditions for maintaining cobS stability and activity?

The stability of recombinant C. beijerinckii cobS is highly dependent on proper storage conditions. According to manufacturer recommendations, the following guidelines should be followed:

Storage FormTemperatureShelf LifeKey Recommendations
Liquid-20°C/-80°C6 monthsAvoid repeated freeze-thaw cycles
Lyophilized-20°C/-80°C12 monthsPreferred for long-term storage
Working solution4°CUp to 1 weekAliquot to minimize deterioration

For reconstitution of lyophilized protein, deionized sterile water should be used to achieve a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol (final concentration) is recommended for stored samples, with 50% being the standard formulation for maximum stability . Prior to opening, vials should be briefly centrifuged to ensure contents are collected at the bottom.

What genetic barriers must be overcome when working with C. beijerinckii cobS genes?

C. beijerinckii presents several genetic manipulation challenges that researchers must address when working with cobS genes. Analysis of the C. beijerinckii Br21 genome has identified several restriction-modification (RM) systems that can interfere with transformation efficiency. Specifically, the genome contains type I RM system genes including hsdR (locus tags: CBEIBR21_17865, CBEIBR21_00480, CBEIBR21_13600) encoding endonuclease components, and hsdM (locus tag: CBEIBR21_17880) encoding methylase components .

This RM system produces N6-methyladenosine (m6A) methylated bases. When introducing recombinant plasmids, researchers should consider using E. coli strains with compatible methylation patterns for plasmid preparation, such as E. coli XL1-Blue MRF' which also encodes a type I RM system . This compatibility reduces the risk of restriction digestion of the introduced DNA.

How can transformation efficiency be improved when introducing cobS-containing vectors?

To overcome the genetic barriers inherent in C. beijerinckii, researchers have successfully established transformation methods using modular vectors . Several strategies can enhance transformation efficiency:

  • Pre-methylation of plasmid DNA using extracts from the target strain

  • Heat inactivation of restriction enzymes before transformation

  • Optimization of electroporation parameters specific to C. beijerinckii

  • Selection of plasmid backbones that minimize recognition by native restriction systems

  • Development of specialized transformation protocols that account for the oxygen sensitivity of this anaerobic bacterium

These methodological improvements are particularly important given that C. beijerinckii has traditionally had limited genetic tools available compared to model organisms, making any enhancements to transformation efficiency valuable for advancing cobS research .

How does cobS activity integrate with broader metabolic pathways in C. beijerinckii?

Cobalamin synthase functions within a complex metabolic network in C. beijerinckii, with implications extending beyond vitamin B12 synthesis. As a non-solventogenic C. beijerinckii isolate, strains containing functional cobS contribute to specific metabolic capabilities:

  • Glycerol metabolism pathways, including conversion to 1,3-propanediol (1,3-PDO) that may depend on B12-dependent enzymes

  • Metabolic flexibility that allows adaptation to different carbon sources

  • Production of short-chain fatty acids (SCFAs) that may be influenced by B12 availability

Research has demonstrated that overexpression of related metabolic genes (dhaB1, dhaB2, pduO, and dhaT) in C. beijerinckii Br21 resulted in a 35% increase in 1,3-PDO productivity compared to non-transformed clones (0.27 vs. 0.20 mmol L⁻¹ h⁻¹) . This suggests that cobS-dependent pathways potentially interact with these industrially relevant metabolic routes.

What implications does cobS function have for microbial ecology studies?

Cobalamin availability, which depends on enzymes like cobS, significantly impacts microbial community dynamics. Studies examining cobalamin supplementation in colonic simulations have demonstrated that different forms of cobalamin (methylcobalamin vs. cyanocobalamin) distinctly influence microbial composition .

After 7 days of supplementation, methylcobalamin reduced gut microbiota diversity compared to control and cyanocobalamin groups . This finding has implications for understanding how cobalamin-producing bacteria like C. beijerinckii might influence microbial community structures in natural environments.

Additionally, cobalamin supplementation altered short-chain fatty acid (SCFA) profiles, with the methylcobalamin group showing higher butyric acid proportions initially, followed by gradual decreases and propionic acid increases over time . These observations suggest that cobS function in C. beijerinckii may have broader ecological consequences through its contribution to cobalamin synthesis.

How should researchers approach contradictory findings in cobS functional studies?

Contradictions in scientific literature regarding enzyme function are common and particularly challenging for specialized enzymes like cobS. A systematic approach to resolving such contradictions should include:

  • Context identification: Examine whether contradictory findings might result from unspecified experimental contexts, such as strain variations, growth conditions, or analytical methods .

  • Experimental validation: Implement multiple orthogonal techniques to verify findings, reducing dependence on any single analytical approach.

  • Parameter standardization: Document and standardize all experimental parameters including temperature, pH, oxygen exposure, and buffer compositions.

  • Statistical rigor: Apply appropriate statistical methods to determine whether apparent contradictions reflect biological variance rather than technical artifacts.

One study examining apparent contradictions in literature-derived knowledge graphs estimated that approximately 2.6% of relationship pairs contained contradictions . Most of these were resolved by identifying missing contextual information such as study population, species differences, or dosage variations, rather than reflecting true scientific disagreement.

What analytical approaches can help resolve discrepancies in cobS characterization data?

When facing contradictory data regarding cobS properties or function, researchers should implement a multi-faceted analytical strategy:

Analytical ApproachApplicationAdvantage for Resolving Contradictions
Principal Component AnalysisIdentifying patterns across experimental variationsCan reveal underlying factors driving apparent contradictions
Multiple sequence alignmentComparing cobS variants across strainsIdentifies structural differences that might explain functional variations
Enzymatic assays under varied conditionsTesting activity across pH, temperature, substrate rangesEstablishes conditional boundaries for enzyme function
Metabolomics analysisQuantifying downstream metabolitesProvides functional readout of enzyme activity in cellular context

As demonstrated in a study on cobalamin effects, principal component analysis successfully revealed that while intergroup differences were minimal in most cases, significant distinctions emerged under specific conditions (e.g., methylcobalamin group on day 7) . This highlights how appropriate analytical methods can identify specific contexts where apparent contradictions become meaningful biological differences.

How might computational approaches enhance understanding of cobS structure-function relationships?

Advanced computational methods offer powerful approaches for investigating cobS structure-function relationships, particularly valuable given the experimental challenges in working with this enzyme. Key computational strategies include:

  • Knowledge graph (KG) construction: Integration of literature-derived biomedical data into semantic networks can identify hidden relationships between cobS and other cellular components. These knowledge graphs can help predict interactions and functional pathways not immediately evident from isolated experimental studies .

  • Link prediction algorithms: When applied to biological knowledge graphs, these can generate hypotheses about cobS interactions with other proteins, substrates, or regulatory molecules .

  • Artificial intelligence methods: Machine learning approaches trained on protein structure-function relationships can predict critical residues, functional domains, and potential engineering targets within the cobS enzyme .

  • Context-aware inference methods: These computational approaches can incorporate tissue specificity, environmental conditions, and other contextual factors that influence enzyme function, helping reconcile apparently contradictory experimental findings .

What emerging technologies might advance cobS research beyond current limitations?

Several emerging technologies hold promise for overcoming current limitations in cobS research:

  • CRISPR-Cas9 genetic tools adapted for Clostridium species: Development of more efficient genome editing tools would enable precise genetic manipulation of cobS and related genes in their native context.

  • Single-cell metabolomics: This technology could reveal cell-to-cell variations in cobalamin synthesis within C. beijerinckii populations, providing insights into regulatory mechanisms.

  • Structural biology advances: Cryo-electron microscopy could elucidate the complete structure of cobS without requiring protein crystallization, potentially revealing dynamic structural features.

  • Synthetic biology frameworks: Development of standardized genetic parts for Clostridium would facilitate more sophisticated cobS engineering approaches.

  • Microfluidic cultivation techniques: These systems would enable high-throughput phenotypic characterization of cobS variants under precisely controlled environmental conditions, particularly valuable for obligate anaerobes like C. beijerinckii.

What controls are essential when studying recombinant C. beijerinckii cobS activity?

Robust experimental design for cobS functional studies requires carefully selected controls to ensure valid and reproducible results:

  • Empty vector controls: Cells transformed with vectors lacking the cobS gene help distinguish between effects caused by the recombinant protein versus those resulting from the expression system itself.

  • Enzymatic activity controls: Including both positive controls (known functional cobS from related species) and negative controls (denatured enzyme or reaction mixtures lacking essential cofactors).

  • Strain background controls: Wild-type C. beijerinckii and cobS knockout strains provide essential reference points for phenotypic comparisons.

  • Environmental controls: Strict anaerobic conditions must be maintained, typically by flushing systems with nitrogen (as demonstrated in cobalamin study methods where headspace was flushed with N₂ three times daily) .

  • Metabolic pathway controls: Monitoring related enzymes and metabolites helps contextualize cobS activity within the broader metabolic network.

How should researchers design experiments to evaluate cobS activity across different physiological conditions?

To comprehensively characterize cobS activity across physiological conditions, researchers should implement a systematic experimental design approach:

  • Factorial design: Systematically vary temperature, pH, substrate concentration, and cofactor availability to identify optimal conditions and potential interaction effects.

  • Time-course studies: Monitor activity over extended periods (e.g., 7+ days as in cobalamin supplementation studies) to capture dynamic changes in enzyme function and metabolite production.

  • In vitro vs. in vivo comparisons: Conduct parallel studies with purified recombinant cobS and engineered strains expressing the enzyme to distinguish between direct enzymatic effects and cellular regulatory influences.

  • Environmental simulation: When applicable, use systems that simulate relevant environmental conditions, such as the colonic simulation approach used in cobalamin studies that maintained 37°C, pH 6.8, and anaerobic conditions .

  • Standardized analytical methods: Implement consistent quantification techniques for enzyme activity and metabolite production to enable cross-experimental comparisons.

What unexplored aspects of cobS function represent promising research opportunities?

Despite current knowledge, several aspects of cobS function remain underexplored and represent valuable research opportunities:

  • Regulatory mechanisms: How expression and activity of cobS respond to environmental cues remains poorly characterized, particularly in non-model organisms like C. beijerinckii.

  • Protein-protein interactions: Potential interactions between cobS and other enzymes in the cobalamin synthesis pathway could reveal coordinated regulation mechanisms.

  • Evolutionary adaptations: Comparative studies across Clostridium species could identify specialized adaptations in cobS structure and function related to different ecological niches.

  • Metabolic integration: The broader implications of cobS function on global cellular metabolism beyond direct cobalamin synthesis pathways represent an important knowledge gap.

  • Engineering potential: Systematic protein engineering studies could develop cobS variants with enhanced stability or catalytic efficiency for biotechnological applications.

How might improved understanding of cobS contribute to broader biotechnological applications?

Enhanced knowledge of C. beijerinckii cobS has several potential biotechnological implications:

  • Metabolic engineering: Understanding cobS function could inform strategies for engineering C. beijerinckii strains with improved production of industrially relevant chemicals. Previous work has demonstrated that overexpression of related pathway genes enhanced 1,3-PDO productivity by 35% , suggesting cobS engineering might yield similar improvements.

  • Vitamin B12 production: Optimized cobS variants could potentially enhance cobalamin synthesis, addressing nutritional supplementation needs.

  • Microbial community engineering: Given that cobalamin significantly influences microbial community composition , engineered cobS-expressing strains could potentially modulate microbiomes for agricultural, environmental, or medical applications.

  • Biosensor development: cobS-based detection systems might enable monitoring of relevant metabolites or environmental conditions.

  • Synthetic biology platforms: C. beijerinckii with optimized cobS pathways could serve as chassis organisms for producing complex biomolecules requiring cobalamin-dependent enzymes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.