Recombinant Clostridium beijerinckii Glucitol/sorbitol permease IIC component (srlA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
srlA; gutA1; Cbei_0336; PTS system glucitol/sorbitol-specific EIIC component; EIIC-Gut; Glucitol/sorbitol permease IIC component
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) (Clostridium acetobutylicum)
Target Names
srlA
Target Protein Sequence
MDAIVYFAKGFMYLFEVGGNTFVSWVTGIIPKVLLLLVFMNSIIAFIGQDKVDRFAKFAS RNVILAYGVLPFLSAFMLGNPMALSMGKFLPERMKPSYYASASYHCHTNSGIFPHINVGE IFIYLGIANGITTLGLDPTALGLRYLLVGLVMNFFAGWVTDFTTKIVMRQQGIELSNQLK AN
Uniprot No.

Target Background

Function

The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a primary carbohydrate transport system, catalyzes the phosphorylation and translocation of sugar substrates across the cell membrane. The enzyme II complex, comprising SrlA, SrlB, and SrlE, facilitates glucitol/sorbitol transport.

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of the glucitol/sorbitol permease IIC component in C. beijerinckii?

The glucitol/sorbitol permease IIC component in C. beijerinckii is part of the phosphotransferase system (PTS) responsible for glucitol uptake and phosphorylation. Based on genetic analysis, the permease complex is encoded by two separate genes, gutA1 and gutA2, which together form enzyme IIBC comprising three domains in the order CBC (where C represents the membrane-spanning domains responsible for sugar translocation) . This differs from the E. coli system where a single gutA gene encodes the entire permease function. The permease IIC component specifically functions as the transmembrane channel through which glucitol enters the cell during the phosphorylation process .

How is the glucitol permease system organized genetically in C. beijerinckii?

In C. beijerinckii NCIMB 8052, the glucitol transport and metabolism genes are organized in a specific cluster. Sequencing reveals five open reading frames (ORFs) in the order gutA1-gutA2-orfX-gutB-gutD within a 4.0-kbp region . The gutA1 and gutA2 genes encode two polypeptides forming enzyme IIBC of the glucitol PTS, while gutB encodes domain IIA of the glucitol PTS. The gutD gene encodes glucitol 6-phosphate dehydrogenase, and orfX encodes an enzyme with similarities to transaldolases . This genetic organization is similar to but distinct from the gut operon in E. coli, with the notable difference being the split of the E. coli gutA gene into two separate genes in C. beijerinckii .

What is the relationship between glucitol metabolism and the permease IIC component in C. beijerinckii?

The permease IIC component plays a crucial role in the first step of glucitol metabolism in C. beijerinckii. The complete metabolic pathway involves: 1) Uptake and phosphorylation of glucitol via the PTS system (involving the IIC component) to form glucitol 6-phosphate; 2) Oxidation of glucitol 6-phosphate by glucitol 6-phosphate dehydrogenase (encoded by gutD) to form fructose 6-phosphate; and 3) Further processing of fructose 6-phosphate through central metabolic pathways . This mechanism is similar to glucitol metabolism in Clostridium pasteurianum and E. coli. The permease IIC component is therefore essential for initiating glucitol catabolism by facilitating its entry into the cell coupled with phosphorylation .

What are the most effective protocols for expressing recombinant C. beijerinckii glucitol permease IIC component in heterologous systems?

For optimal expression of the recombinant C. beijerinckii glucitol permease IIC component in heterologous systems, researchers should consider the following methodological approach:

  • Vector Selection: For membrane proteins like the IIC component, vectors with tightly controlled inducible promoters (such as pET systems for E. coli) are recommended to prevent toxicity from overexpression.

  • Host Selection: E. coli strains designed for membrane protein expression (such as C41/C43(DE3) or Lemo21(DE3)) have proven effective for similar PTS components. This approach is supported by the successful complementation of E. coli gutD mutants with C. beijerinckii genes, suggesting compatibility between the systems .

  • Expression Conditions:

    • Induction at lower temperatures (16-20°C)

    • Lower inducer concentrations

    • Extended expression times (overnight)

    • Supplementation with stabilizing agents

  • Purification Strategy:

    • Membrane fraction isolation using differential centrifugation

    • Solubilization with mild detergents (DDM, LDAO)

    • Affinity chromatography using His-tags positioned to avoid interference with protein folding

Given the unique split architecture of the C. beijerinckii permease (gutA1 and gutA2), co-expression of both components may be necessary for proper folding and function .

How can researchers effectively analyze the regulatory mechanisms controlling expression of the glucitol permease in C. beijerinckii?

Analyzing the regulatory mechanisms controlling glucitol permease expression requires a multi-faceted experimental approach:

  • Transcriptional Analysis:

    • qRT-PCR for quantifying mRNA levels of gutA1/gutA2 under different conditions

    • Northern blot analysis to determine operon structure and transcript stability

    • RNA-seq to identify global transcriptional changes in response to glucitol

  • Promoter Analysis:

    • Reporter gene fusions (such as lacZ or gfp) to identify promoter regions

    • Site-directed mutagenesis of putative regulatory elements

    • DNA-protein interaction assays (EMSA, DNase footprinting) to identify binding sites for regulatory proteins

  • Regulatory Protein Identification:

    • Chromatin immunoprecipitation (ChIP) to identify DNA-binding regulators

    • Proteomic analysis to identify differentially expressed regulatory proteins

  • Metabolic Control Analysis:

    • Measurement of intracellular metabolites that may serve as effector molecules

    • Analysis of HPr phosphorylation status, as HPr protein plays a pivotal role in regulation of carbohydrate metabolism in gram-positive bacteria

Research has shown that the gut genes in C. beijerinckii are both induced by glucitol and repressed by glucose. RNA analysis demonstrated that gut-specific mRNA is not detected during growth on glucose but appears when glucitol utilization begins . The mechanism may involve competition between glucose and glucitol PTSs for phospho-HPr, similar to the "inducer exclusion" phenomenon observed in C. pasteurianum .

What structural and functional differences exist between the IIC domain in C. beijerinckii and those in other bacterial species?

The structural and functional differences between the IIC domain in C. beijerinckii and those in other bacterial species present an important research area:

FeatureC. beijerinckiiE. coliOther Gram-positive bacteria
Genetic organizationSplit into gutA1 and gutA2 genesSingle gutA geneVariable, often single gene
Domain architectureCBC arrangement with split polypeptidesCBC in single polypeptideTypically CBC in single polypeptide
Membrane topologyLikely 8-10 transmembrane segments8 transmembrane segments8-10 transmembrane segments
Substrate specificityGlucitol-specificGlucitol-specificVariable specificity for polyols
RegulationGlucitol-induced, glucose-repressedGlucitol-induced, cAMP-CRP regulatedOften CCR-regulated via HPr

The unique split architecture of the C. beijerinckii IIC component (encoded by separate gutA1 and gutA2 genes) represents a significant divergence from the typical single-polypeptide organization found in E. coli and most other bacteria . This arrangement raises intriguing questions about protein assembly and evolution. The two segments of the C. beijerinckii protein were found to be contiguous when aligned with the E. coli permease, suggesting a potential evolutionary event that split the original gene .

Functional differences may also exist in substrate recognition, transport efficiency, and regulatory mechanisms. The split nature of the protein might allow for more nuanced regulation or altered transport kinetics compared to single-polypeptide versions.

What methods are most effective for analyzing the interaction between the glucitol permease IIC component and other PTS proteins in C. beijerinckii?

Analyzing protein-protein interactions within the PTS system requires specialized approaches for membrane proteins:

  • In vivo approaches:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • FRET/BRET using fluorescent protein fusions to detect proximity

    • Cross-linking followed by co-immunoprecipitation to capture transient interactions

    • Split-protein complementation assays

  • In vitro approaches:

    • Surface plasmon resonance (SPR) with purified components

    • Isothermal titration calorimetry (ITC) for binding thermodynamics

    • Native mass spectrometry for intact complex analysis

    • Proteoliposome reconstitution for functional interaction studies

  • Structural approaches:

    • Cryo-electron microscopy of reconstituted complexes

    • X-ray crystallography (challenging for membrane proteins)

    • Cross-linking mass spectrometry (XL-MS) to map interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

Research has demonstrated that within the glucitol PTS of C. beijerinckii, there are specific interactions between components. The glucitol phosphorylation assays using soluble and membrane fractions confirmed that gutB encodes a separate, soluble, glucitol-specific PTS component that interacts with the membrane-bound IIBC components encoded by gutA1 and gutA2 . Understanding these interactions is critical for elucidating the complete phosphoryl transfer pathway.

What are the optimal conditions for assaying glucitol permease activity in C. beijerinckii?

The optimal conditions for assaying glucitol permease activity in C. beijerinckii involve several methodological considerations:

  • Cell Preparation:

    • Culture C. beijerinckii anaerobically in media containing glucitol as the sole carbon source to induce expression of the permease

    • Harvest cells during exponential growth phase

    • Wash cells with buffer free of carbon sources to remove residual media

    • Ensure glucose is completely depleted as it represses the gut system

  • Assay Conditions:

    • Buffer composition: Typically phosphate buffer (pH 7.0-7.5) with appropriate salts

    • Temperature: 30-37°C (optimal growth temperature for C. beijerinckii)

    • Anaerobic conditions maintained throughout the assay

    • Inclusion of PEP as phosphoryl donor

    • Addition of general PTS proteins (HPr, Enzyme I) if using membrane fractions

  • Activity Measurement Methods:

    • Direct uptake assays using radiolabeled [14C]-glucitol

    • Indirect assays measuring PEP-dependent phosphorylation

    • Coupled enzyme assays detecting glucitol 6-phosphate formation

  • Controls and Validation:

    • Positive control: Cells grown on glucitol (known to express the permease)

    • Negative control: Cells grown on glucose only (permease expression repressed)

    • Competitive inhibition with unlabeled substrate to confirm specificity

Research has demonstrated that the glucitol PTS activity in C. beijerinckii is specifically induced by glucitol and absent from cells grown on other carbon sources like glucose or xylose . The system is repressed by glucose, and activity is only detected after glucose depletion, so timing of cell harvest is critical for experimental success .

How can researchers effectively generate and validate knockout or modified strains targeting the glucitol permease genes in C. beijerinckii?

Generating and validating knockout or modified strains targeting the glucitol permease genes requires specialized approaches for clostridia:

  • Gene Knockout Strategies:

    • ClosTron system (Group II intron-based)

    • CRISPR-Cas9 system adapted for C. beijerinckii

    • Homologous recombination with antibiotic resistance markers

    • Antisense RNA approaches for knockdown studies

  • Targeted Integration Methodology:

    • Design constructs with homology arms flanking gutA1 or gutA2

    • Include selectable markers appropriate for C. beijerinckii

    • Transform using electroporation under anaerobic conditions

    • Select transformants on appropriate media containing antibiotics

  • Validation Methods:

    • PCR verification of integration or deletion

    • Southern blot analysis to confirm single integration

    • Whole genome sequencing to detect potential off-target effects

    • Transcriptional analysis (RT-PCR, RNA-seq) to confirm gene disruption

    • Activity assays to verify loss of function

  • Phenotypic Characterization:

    • Growth curve analysis on different carbon sources

    • Metabolite profiling using HPLC or GC-MS

    • Substrate utilization assays (specifically for glucitol)

    • Complementation studies to confirm phenotype is due to the targeted mutation

Previous research successfully created a gutD knockout in C. beijerinckii by targeted integration, resulting in a strain that lacked glucitol 6-phosphate dehydrogenase activity . This approach demonstrates the feasibility of genetic manipulation targeting components of the glucitol utilization pathway.

What analytical techniques are most effective for studying the membrane topology and structure of the glucitol permease IIC component?

Studying membrane topology and structure of the glucitol permease IIC component requires specialized analytical techniques:

  • Computational Prediction Methods:

    • Hydropathy analysis to predict transmembrane segments

    • Topology prediction algorithms (TMHMM, TOPCONS)

    • Homology modeling based on structurally characterized PTS permeases

    • Molecular dynamics simulations to predict dynamic behavior

  • Experimental Topology Mapping:

    • Cysteine scanning mutagenesis with thiol-reactive reagents

    • Reporter fusion approaches (PhoA, LacZ, GFP)

    • Proteolytic digestion followed by mass spectrometry

    • Substituted-cysteine accessibility method (SCAM)

  • Structural Analysis Techniques:

    • Cryo-electron microscopy of purified protein

    • X-ray crystallography (challenging but possible with appropriate constructs)

    • Solid-state NMR spectroscopy

    • EPR spectroscopy with site-directed spin labeling

    • FRET measurements to determine intramolecular distances

  • Functional Validation:

    • Site-directed mutagenesis of predicted functional residues

    • Transport assays with modified proteins

    • Accessibility studies using membrane-impermeable reagents

The unique split architecture of the C. beijerinckii glucitol permease (encoded by gutA1 and gutA2) presents both challenges and opportunities for structural studies . While this architecture complicates expression and purification, it also provides natural truncation points that can be exploited for structural analysis of individual domains.

How should researchers interpret discrepancies in experimental results when studying the glucitol permease function in different strains of C. beijerinckii?

When encountering discrepancies in experimental results across different C. beijerinckii strains, researchers should consider the following analytical approach:

  • Genetic Variation Analysis:

    • Sequence the gut genes from different strains to identify polymorphisms

    • Perform comparative genomics to identify potential strain-specific regulatory elements

    • Check for presence of mobile genetic elements that might disrupt gene function

    • Analyze copy number variations that might affect expression levels

  • Expression Level Assessment:

    • Quantify mRNA levels using qRT-PCR or RNA-seq

    • Perform Western blot analysis to compare protein expression

    • Use reporter gene fusions to monitor promoter activity

    • Compare transcriptional profiles under identical growth conditions

  • Functional Activity Comparison:

    • Standardize enzyme assay conditions across strains

    • Determine kinetic parameters (Km, Vmax) for the permease in each strain

    • Assess substrate specificity profiles for potential differences

    • Measure induction kinetics in response to glucitol

  • Regulatory Network Analysis:

    • Compare catabolite repression mechanisms between strains

    • Analyze HPr phosphorylation patterns

    • Evaluate cross-talk with other carbohydrate utilization systems

    • Investigate potential strain-specific regulators

The gut genes in C. beijerinckii are known to be regulated at the transcriptional level, induced by glucitol, and repressed by glucose . Strain variations in these regulatory mechanisms could account for functional differences. Additionally, strain-specific differences in membrane composition might affect permease function or stability.

What bioinformatic approaches can best analyze evolutionary relationships between glucitol permease components across Clostridium species?

For analyzing evolutionary relationships between glucitol permease components across Clostridium species, researchers should employ the following bioinformatic strategies:

  • Sequence-Based Phylogenetic Analysis:

    • Multiple sequence alignment of IIC domain sequences

    • Construction of phylogenetic trees using maximum likelihood or Bayesian methods

    • Calculation of evolutionary distances between homologs

    • Identification of conserved motifs specific to glucitol/sorbitol transport

  • Comparative Genomics Approaches:

    • Analysis of gene synteny across different species

    • Identification of operon structures and their conservation

    • Analysis of horizontal gene transfer events

    • Detection of gene fusion/fission events like the split gutA1/gutA2 in C. beijerinckii

  • Structural Bioinformatics:

    • Homology modeling based on known PTS permease structures

    • Prediction of structurally conserved regions

    • Analysis of co-evolving residues to predict interaction interfaces

    • Molecular dynamics simulations to compare functional dynamics

  • Functional Domain Analysis:

    • Identification of substrate-binding residues and their conservation

    • Analysis of domain architecture variations across species

    • Prediction of specialized functional adaptations

    • Classification of homologs into functional subgroups

The unique arrangement of gutA1 and gutA2 genes in C. beijerinckii compared to the single gutA gene in E. coli represents an interesting evolutionary divergence . Sequence alignment shows that the two segments of the C. beijerinckii protein are contiguous when compared with the E. coli permease, suggesting a gene splitting event in the evolutionary history of C. beijerinckii .

What are the most promising approaches for engineering the glucitol permease IIC component to improve substrate specificity or transport efficiency?

Engineering the glucitol permease IIC component for improved properties could follow several promising research directions:

  • Structure-Guided Mutagenesis:

    • Target residues in the substrate-binding pocket based on homology models

    • Introduce mutations that alter the size or chemical properties of the binding pocket

    • Modify gating residues that control substrate access

    • Engineer inter-domain interfaces to optimize conformational changes during transport

  • Directed Evolution Strategies:

    • Develop high-throughput screening systems for permease variants

    • Apply error-prone PCR to generate mutation libraries

    • Use growth selection in minimal media with alternative substrates

    • Implement compartmentalized self-replication methods

  • Domain Swapping and Chimeric Proteins:

    • Create chimeras between C. beijerinckii and other bacterial permeases

    • Exchange substrate recognition loops between related transporters

    • Exploit the natural split architecture of C. beijerinckii permease (gutA1/gutA2) to facilitate domain engineering

    • Test fusion proteins with alternative configurations

  • Synthetic Biology Approaches:

    • Redesign the operon structure for optimized expression

    • Introduce synthetic regulatory elements to overcome glucose repression

    • Co-express engineered permease variants with complementary metabolic enzymes

    • Develop biosensor systems for rapid screening of improved variants

The unique split architecture of the C. beijerinckii glucitol permease (gutA1/gutA2) offers advantages for protein engineering, as individual domains can be modified separately before co-expression . This approach could facilitate more targeted modifications than would be possible with a single-polypeptide permease.

How might research on C. beijerinckii glucitol permease contribute to broader understanding of bacterial sugar transport systems?

Research on C. beijerinckii glucitol permease has several implications for our broader understanding of bacterial sugar transport:

  • Evolutionary Insights:

    • The split architecture of gutA1/gutA2 in C. beijerinckii versus the single gutA in E. coli provides evidence for evolutionary mechanisms in membrane protein development

    • Comparison across species can reveal adaptation mechanisms for different ecological niches

    • The study of different PTS architectures contributes to understanding the evolution of modular protein systems

  • Structural Biology Advances:

    • The natural division between gutA1/gutA2 creates natural truncation points that might facilitate structural studies

    • Understanding assembly of split transporters could inform membrane protein folding principles

    • The CBC domain organization provides insights into functional modularity in transporters

  • Regulatory Network Understanding:

    • The glucose repression mechanism of the gut system contributes to understanding carbon catabolite repression in Gram-positive bacteria

    • The role of HPr in regulation connects individual transport systems to global metabolic networks

    • Understanding inducer exclusion mechanisms informs metabolic engineering strategies

  • Biotechnological Applications:

    • Insights from C. beijerinckii permease could inform engineering of other transporters

    • Understanding substrate specificity determinants could enable creation of transporters for non-natural substrates

    • Knowledge of regulatory mechanisms could help overcome sequential utilization of mixed substrates in industrial fermentations

The unique features of the C. beijerinckii glucitol permease system make it a valuable model for understanding both specific adaptations in clostridia and general principles of carbohydrate transport systems across bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.