Recombinant Clostridium beijerinckii Putative AgrB-like protein (cfg02)

Shipped with Ice Packs
In Stock

Description

Genetic Context and Functional Role

The cfg02 gene resides within a 12-kb gene cluster essential for circularin A biosynthesis in C. beijerinckii ATCC 25752 . Key neighboring genes include:

GeneFunction
cfgRKTwo-component regulatory system (histidine kinase and response regulator)
cfg01AgrB homolog; processes cfg02 precursor into a signaling peptide
cirAStructural gene for circularin A bacteriocin
cirB-DSecretion, circularization, and immunity for circularin A

Proposed Regulatory Mechanism :

  1. Cfg02 precursor processing: Cfg01 (AgrB-like protein) cleaves and modifies the cfg02 precursor to generate a mature signaling peptide.

  2. Quorum activation: The peptide activates the CfgRK two-component system, triggering expression of bacteriocin-related genes (e.g., cirA).

  3. Bacteriocin maturation: CirB/CirD/CirC facilitate circularin A secretion and circularization, while CirE confers immunity .

Homology and Evolutionary Insights

Cfg02 shares 34% sequence identity with hypothetical proteins in Clostridium acetobutylicum and Clostridium perfringens, suggesting conserved roles in Gram-positive bacteria . Despite this, cfg02 lacks homologs in public databases, making it unique to C. beijerinckii and related clostridia .

Biotechnological and Research Applications

  • Bacteriocin Production: Essential for regulated synthesis of circularin A, a potential food preservative and antimicrobial agent .

  • Quorum-Sensing Studies: Serves as a model for Agr-like systems in anaerobic bacteria .

  • Structural Biology: Hydrophobic domains and post-translational modifications make cfg02 a candidate for membrane protein studies .

Transcriptomic and Genomic Relevance

Transcriptomic analyses of engineered C. beijerinckii strains reveal upregulated two-component systems (e.g., cfgRK) under stress, indirectly implicating cfg02 in metabolic adaptation . Genomic comparisons of C. beijerinckii strains highlight mobile genetic elements near cfg02, potentially influencing strain-specific bacteriocin production .

Challenges and Future Directions

  • Functional Validation: Direct evidence for cfg02’s role in peptide signaling remains inferred .

  • Structural Resolution: No crystallographic data exist for cfg02; structural studies could clarify its interaction with Cfg01/CfgRK.

  • Industrial Scaling: Recombinant production in E. coli faces challenges in yield and solubility .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time details.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize developing it for your order.
Synonyms
cfg02; Putative AgrB-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Clostridium beijerinckii (Clostridium MP)
Target Names
cfg02
Target Protein Sequence
MIKYLSTNISLYFQENNSCLSKKDVLKIQYTLEAILSDLSKFIIIFLVFLFIKEIPLFLF SFIILNSTRPLLGGIHCKTYYGCLTCSILYFMIILLFTRLFPELNTNFYIVFFILSLAIT FIFAPCPNEKRPVKNKATLKILSLISLTFWIILFYLSPLQTRNCILISIFLQIIQVIIIN TKGVIFNAKNNKTFFNRTT
Uniprot No.

Target Background

Function
This protein may play a role in the proteolytic processing of a quorum sensing system signal molecule precursor.
Protein Families
AgrB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What genetic modifications have been shown to enhance butanol production in C. beijerinckii when grown on lactose?

The introduction of methylglyoxal synthase (mgsA) and methylglyoxal reductase (mgR) genes from C. pasteurianum into C. beijerinckii has demonstrated significant improvement in butanol production. This recombinant strain, designated as C. beijerinckii_mgsA+mgR, produces 87% more butanol when grown on lactose compared to the control strain (C. beijerinckii_p459) . The enhanced butanol production results from comprehensive metabolic remodeling that increases lactose uptake and catabolism while altering various biosynthetic pathways. To implement this modification, researchers clone the mgsA and mgR genes and co-express them in C. beijerinckii, typically using an appropriate expression vector with selection markers such as erythromycin resistance .

How does transcriptomic profiling help understand the metabolic changes in engineered C. beijerinckii strains?

Transcriptomic profiling through RNA sequencing reveals the global gene expression patterns that underlie phenotypic changes in engineered strains. In the case of C. beijerinckii_mgsA+mgR, RNA-seq analysis identified 300 genes with increased mRNA abundance and 433 genes with decreased mRNA abundance compared to the control strain . These expression changes highlight the metabolic and cellular adaptations that contribute to enhanced butanol production. The methodology involves:

  • Isolating total RNA from cultures at comparable growth stages (typically at OD600 ~1.0)

  • Removing DNA contamination using DNase I treatment

  • Depleting ribosomal RNA and preparing sequencing libraries

  • Performing high-throughput sequencing (e.g., using Illumina NextSeq2000)

  • Analyzing differential gene expression using bioinformatic tools like Kallisto and DeSeq2

This comprehensive approach identifies key pathways that can be further manipulated to optimize butanol production.

What are the main categories of genes showing altered expression in butanol-enhanced C. beijerinckii strains?

The engineered C. beijerinckii_mgsA+mgR strain exhibits significant changes in several functional gene categories compared to the control strain:

Gene CategoryProportion of Upregulated GenesPrimary Functions
Nutrient/nucleotide transport and metabolism82 genes (27.33%)Lactose uptake and catabolism
Signal transduction and motilityMultiple genes including CheA, fliI, CheBCell motility and environmental response
Iron uptakefeoA, feoB and related genesIron acquisition and metabolism
Vitamin biosynthesisGenes for vitamins B5 and B12Cofactor production
Amino acid biosynthesisaroH and related genesTryptophan and aromatic amino acid synthesis

Conversely, genes showing decreased expression include those involved in:

  • Fe-S cluster proteins and metabolism

  • L-aspartate-dependent NAD biosynthesis

  • Lysine and asparagine biosynthesis

  • Capsular polysaccharide production

  • Stress response mechanisms

These expression patterns indicate a substantial metabolic reprogramming that enhances carbon flux toward butanol production.

How can RNA sequencing protocols be optimized for accurate transcriptomic characterization of recombinant C. beijerinckii strains?

Optimizing RNA sequencing for C. beijerinckii transcriptomic studies requires several critical methodological considerations:

  • Culture synchronization: Since C. beijerinckii_mgsA+mgR and control strains may exhibit different growth rates, samples should be collected at equivalent physiological states rather than at identical time points. The research shows collection at OD600 ~1.0 provides comparable results .

  • RNA quality control: Complete DNA removal is essential and should be verified using PCR amplification of housekeeping genes (such as rpoD) after DNase treatment. RNA quality and quantity assessment using UV-Vis spectrophotometry is crucial before proceeding with library preparation .

  • rRNA depletion optimization: Since bacterial mRNA lacks poly(A) tails, rRNA depletion (rather than poly(A) selection) is necessary. The Ribo-Zero Plus Microbiome kit has proven effective for C. beijerinckii .

  • Sequencing depth: Generating approximately 50M 2×150bp paired reads provides sufficient coverage for comprehensive transcriptome analysis of C. beijerinckii .

  • Bioinformatic pipeline: Using Trimmomatic for read processing, followed by Kallisto for expression quantification and DeSeq2 for differential expression analysis, with appropriate statistical thresholds (fold changes ≥1.2 Log2 with P<0.05) .

Proper implementation of these methodological approaches ensures reliable transcriptomic data that accurately reflects the biological differences between recombinant and control strains.

What approaches are effective for validating RNA-seq findings in engineered C. beijerinckii strains?

Validation of RNA-seq data is essential to confirm differential expression patterns. For C. beijerinckii transcriptomic studies, RT-qPCR serves as the primary validation method:

  • cDNA synthesis: After isolating RNA from biological triplicates, cDNA should be synthesized using commercial kits like iScript cDNA Synthesis Kit .

  • Primer design: Gene-specific primers must be designed for target genes showing significant differential expression. The primers should have similar melting temperatures and generate amplicons of comparable sizes .

  • Reference gene selection: The RNA polymerase sigma factor gene (rpoD, Cbei_0853) has been established as a reliable housekeeping gene for normalization in C. beijerinckii .

  • Quantification method: The 2^-ΔΔCt method effectively calculates relative expression levels between recombinant and control strains .

  • Data analysis: Results should be presented as average values of three biological replicates with standard deviation to ensure statistical reliability .

The research demonstrates validation for key genes involved in various metabolic pathways, including NAD biosynthesis (nadA, nadB, nadC), oxidoreductases, transporters, and signal transduction proteins .

How does iron availability influence gene expression and butanol production in engineered C. beijerinckii strains?

Iron availability significantly impacts gene expression patterns and metabolic performance in recombinant C. beijerinckii strains. Transcriptomic analysis of C. beijerinckii_mgsA+mgR revealed:

  • Differential expression of iron uptake genes: The engineered strain showed increased expression of iron uptake genes including feoA and feoB, suggesting altered iron metabolism .

  • Reduced expression of Fe-S cluster proteins: A widespread decrease in mRNA abundance for Fe-S proteins was observed in C. beijerinckii_mgsA+mgR compared to the control strain .

To experimentally investigate these observations, researchers employed a methodical approach:

  • Medium modification: Standard fermentation medium was modified to contain a fivefold reduction in iron concentration (2.0 mg/L FeSO4·7H2O instead of 10.0 mg/L) .

  • Comparative growth analysis: Both strains were cultivated in iron-deficient medium for 72 hours with regular sampling to monitor growth kinetics .

  • Metabolite analysis: Acid (acetic and butyric acids) and solvent (acetone, butanol, and ethanol) production were quantified using gas chromatography .

These experiments demonstrate how iron limitation can be used as an experimental variable to probe the metabolic adaptations in engineered strains, potentially revealing new strategies for optimizing butanol production by manipulating iron availability.

How do signal transduction and motility gene expression patterns correlate with cellular morphology in recombinant C. beijerinckii?

Expression patterns of two-component signal transduction and motility genes provide significant insights into cellular physiology of engineered C. beijerinckii strains:

These findings demonstrate how gene expression patterns directly manifest in observable phenotypic changes, providing a mechanistic link between genetic engineering, gene expression, cellular physiology, and ultimately, improved butanol production.

What role does aspartic acid metabolism play in NAD biosynthesis and butanol production in engineered C. beijerinckii?

Transcriptomic analysis revealed important connections between aspartic acid metabolism, NAD biosynthesis, and butanol production in recombinant C. beijerinckii:

  • Downregulation of L-aspartate-dependent NAD biosynthesis: The engineered C. beijerinckii_mgsA+mgR strain showed reduced expression of genes involved in L-aspartate-dependent de novo NAD biosynthesis, including nadA (quinolinate synthetase), nadB (L-aspartate oxidase), and nadC (nicotinate-nucleotide pyrophosphorylase) .

  • Experimental validation: To investigate the functional implications of this finding, researchers conducted supplementation experiments using aspartic acid:

    • Fermentation medium was supplemented with aspartic acid (2 g/L)

    • Cultures were monitored for 84 hours with regular sampling

    • Growth (OD600), pH, and metabolite concentrations were measured

  • Analytical methods: Gas chromatography was employed to quantify the production of acetone, butanol, ethanol, acetic acid, and butyric acid in aspartic acid-supplemented cultures .

This methodological approach demonstrates how transcriptomic findings can be functionally validated through targeted experimental interventions, providing deeper insights into the metabolic pathways that influence butanol production in engineered C. beijerinckii strains.

What bioinformatic tools and statistical thresholds are recommended for analyzing differential gene expression in C. beijerinckii transcriptomic studies?

Robust bioinformatic analysis of C. beijerinckii transcriptomic data requires appropriate tools and statistical parameters:

  • Quality control and preprocessing:

    • FastQC: Assess sequencing quality metrics

    • Trimmomatic (version 0.39): Remove adapters and low-quality reads/bases

    • DRAGEN v3.10.12: Perform read de-multiplexing, trimming, and run analytics

  • Quantification and mapping:

    • Kallisto (version 2.1.2): Generate count tables and normalized expression levels against the reference genome (C. beijerinckii NCIMB 8052)

  • Differential expression analysis:

    • DeSeq2 (version 2.23.0): Estimate differentially expressed genes and compare expression levels between strains

    • Statistical thresholds: Fold changes ≥1.2 (Log2; equivalent to fold changes ≥2.3 Log10) with P-value <0.05

  • Visualization:

    • EnhancedVolcano (version 2.3, R package): Generate volcano plots for visualizing expression changes

  • Functional annotation:

    • BAKTA (version 1.5.1): Perform functional annotation of genes to understand their biological roles

Applying these tools with appropriate parameters ensures reliable identification of differentially expressed genes and facilitates interpretation of the biological significance of transcriptomic changes in engineered C. beijerinckii strains.

How can morphological differences between engineered and control C. beijerinckii strains be quantified and correlated with transcriptomic data?

Integrating morphological observations with transcriptomic data provides valuable insights into phenotype-genotype relationships in engineered C. beijerinckii strains:

  • Microscopic examination methods:

    • Standard microscopy techniques can be used to observe morphological differences between strains

    • Images should be captured at comparable growth phases (e.g., at OD600 ~1.0)

  • Quantifiable morphological parameters:

    • Cell clustering: The degree of cell aggregation versus discreteness

    • Cell size and shape measurements

    • Motility assessments through time-lapse microscopy

  • Correlation with transcriptomic data:

    • Identify expression changes in genes related to cell wall structure, capsular polysaccharide production, and motility

    • Establish statistical correlations between morphological metrics and expression levels of relevant genes

  • Functional validation:

    • Targeted gene knockout or overexpression studies to confirm the role of specific genes in morphological characteristics

    • Chemical interventions that target specific cellular processes to validate functional relationships

For example, the observed morphological difference between C. beijerinckii_mgsA+mgR (discrete cells) and C. beijerinckii_p459 (clustered cells) correlates with decreased expression of capsular polysaccharide biosynthesis genes and increased expression of motility genes in the engineered strain . This correlation provides a mechanistic understanding of how genetic engineering impacts cellular physiology through altered gene expression patterns.

What metabolic engineering strategies could further enhance butanol production in recombinant C. beijerinckii strains based on current transcriptomic insights?

Transcriptomic analysis of C. beijerinckii_mgsA+mgR provides several promising directions for further metabolic engineering:

  • Targeted optimization of lactose metabolism:

    • The engineered strain shows increased expression of lactose uptake and catabolic genes

    • Further enhancement could involve overexpression of lactose transporters and key metabolic enzymes

    • Engineering lactose-specific regulatory elements to maximize carbon flux to butanol

  • Iron metabolism modulation:

    • Fine-tuning iron uptake systems based on the observed changes in iron uptake genes (feoA, feoB)

    • Optimizing Fe-S cluster protein expression to balance redox reactions during fermentation

  • Vitamin biosynthesis pathway engineering:

    • Enhanced expression of genes involved in vitamins B5 and B12 biosynthesis was observed in the better-performing strain

    • Strategic supplementation or pathway enhancement could further support metabolic efficiency

  • Amino acid metabolism manipulation:

    • Targeting the observed increases in aromatic amino acid biosynthesis, particularly tryptophan

    • Addressing the downregulation of lysine and asparagine biosynthesis to optimize nitrogen metabolism

  • Signal transduction engineering:

    • Modifying two-component signal transduction systems to enhance cellular responses to fermentation conditions

    • Potentially manipulating CheA and related proteins to optimize cellular physiology

These strategies, informed by comprehensive transcriptomic data, provide targeted approaches to further enhance butanol production beyond the 87% improvement already achieved with the mgsA+mgR modification.

How might aspartic acid supplementation protocols be optimized to enhance NAD biosynthesis in engineered C. beijerinckii strains?

Given the observed downregulation of L-aspartate-dependent NAD biosynthesis in C. beijerinckii_mgsA+mgR , optimizing aspartic acid supplementation represents a promising research direction:

  • Concentration optimization:

    • Establish dose-response relationships by testing various aspartic acid concentrations (beyond the 2 g/L tested in current research)

    • Determine the minimum effective concentration that maximizes NAD biosynthesis and butanol production

  • Timing strategies:

    • Explore different supplementation timings during the fermentation process

    • Test pulsed addition versus single addition at fermentation initiation

    • Implement feedback-controlled addition based on real-time monitoring of metabolites

  • Combinatorial approaches:

    • Investigate synergistic effects of aspartic acid with other amino acids or precursors

    • Test combinations with niacin or other NAD precursors to bypass the downregulated de novo synthesis pathway

  • Genetic interventions:

    • Engineer strains with enhanced aspartate uptake capabilities

    • Modify the regulation of NAD biosynthetic genes (nadA, nadB, nadC) to overcome their downregulation

  • Monitoring methodologies:

    • Develop real-time or rapid assays for NAD+/NADH ratios during fermentation

    • Correlate these measurements with butanol production to establish optimal supplementation protocols

These methodological approaches would build upon the current understanding of aspartate metabolism in engineered C. beijerinckii strains and potentially lead to further improvements in butanol production efficiency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.