Recombinant Clostridium beijerinckii UPF0060 membrane protein Cbei_2176 (Cbei_2176)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its implementation.
Synonyms
Cbei_2176; UPF0060 membrane protein Cbei_2176
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) (Clostridium acetobutylicum)
Target Names
Cbei_2176
Target Protein Sequence
MEIIKSILYFILAGIFEIGGGYLIWIWLRDGKSYLYGVIGAVILILYGIIPTLQPSNADF GKVYAAYGGIFIVMSILWGWKIDNIVPDKFDLIGGCIALVGVIVIMYAPRG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for maintaining stability of purified Cbei_2176 protein?

For optimal stability of purified recombinant Cbei_2176 protein, the following storage protocols are recommended:

  • Long-term storage: Store at -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles .

  • Working stock: Aliquots can be maintained at 4°C for up to one week .

  • Storage buffer composition: Tris/PBS-based buffer containing 6% Trehalose, pH 8.0 for lyophilized preparations , or Tris-based buffer with 50% glycerol for liquid preparations .

When reconstituting lyophilized protein, centrifuge the vial briefly before opening to ensure all material is at the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage of reconstituted protein, add glycerol to a final concentration of 5-50% (recommended 50%) and store in aliquots at -20°C/-80°C . This protocol minimizes protein denaturation and preserves functionality for experimental use.

What expression systems are suitable for recombinant production of Cbei_2176?

Based on successful production strategies, Escherichia coli has been demonstrated as an effective heterologous expression system for recombinant Cbei_2176 production . When considering expression systems, researchers should implement the following methodological approaches:

  • Vector selection: Plasmids containing appropriate fusion tags (such as His-tag) that facilitate purification without interfering with protein function.

  • Expression optimization: Temperature, induction time, and inducer concentration should be optimized for membrane protein expression, typically using lower temperatures (16-25°C) and extended expression periods.

  • Cell lysis considerations: Membrane proteins require specialized extraction protocols, typically involving detergents or mechanical disruption methods.

When using E. coli as an expression host, researchers should be aware that membrane proteins often form inclusion bodies. To address this challenge, consider using specialized E. coli strains (such as C41(DE3) or C43(DE3)) designed for membrane protein expression, or explore refolding protocols if the protein forms inclusion bodies .

How can transcriptomic approaches enhance understanding of Cbei_2176 regulation in engineered Clostridium beijerinckii strains?

Transcriptomic analysis offers powerful insights into the regulation and functional role of Cbei_2176 within engineered C. beijerinckii strains. Recent research on recombinant C. beijerinckii strains demonstrates the utility of transcriptomic characterization for understanding global gene expression patterns and metabolic network remodeling .

A comprehensive transcriptomic approach should include:

  • RNA extraction and quality control: Implement rigorous protocols to ensure high-quality RNA isolation from C. beijerinckii, which can be challenging due to its gram-positive cell wall.

  • Sequencing methodology: RNA-Seq with appropriate depth (>20 million reads per sample) to capture low-abundance transcripts.

  • Differential expression analysis: Compare wild-type and engineered strains under identical cultivation conditions to identify significant changes in gene expression patterns.

  • Pathway analysis: Map differential expression data to known metabolic pathways to identify functional implications.

Recent transcriptomic studies of engineered C. beijerinckii strains have revealed broadly contrasting gene expression patterns characterized by:

  • Decreased abundance of mRNAs encoding Fe-S proteins

  • Increased expression of genes involved in lactose uptake and catabolism

  • Differential expression of iron uptake genes and two-component signal transduction systems

  • Modified expression of genes involved in vitamin biosynthesis and amino acid metabolism

These findings suggest that membrane proteins like Cbei_2176 may play important roles in cellular adaptation to genetic modifications, particularly when engineering strains for enhanced butanol production.

What experimental designs are most appropriate for studying the functional role of Cbei_2176 in Clostridium beijerinckii?

When investigating the functional role of Cbei_2176, researchers should consider implementing quasi-experimental designs that allow for robust causal inference despite the challenges of working with anaerobic bacteria. Based on established experimental design principles, the following approaches are recommended:

  • Gene knockout/knockdown studies using:

    • CRISPR-Cas9 system for precise gene editing

    • Antisense RNA strategies for knockdown approaches

    • Homologous recombination for gene replacement

  • Complementation studies to verify phenotypic effects through:

    • Plasmid-based expression of wild-type Cbei_2176 in knockout strains

    • Expression of variant forms to identify critical residues

  • Time-series experimental designs for dynamic analysis:

Quasi-experimental DesignImplementation for Cbei_2176 ResearchKey Benefits
Interrupted time-series designMultiple measurements before and after Cbei_2176 inductionAccounts for temporal trends independent of intervention
One-group pretest-posttest design using a double pretestBaseline measurements, control measurements, then Cbei_2176 inductionControls for maturation and testing effects
Repeated-treatment designAlternating induction and repression of Cbei_2176Demonstrates reproducibility of effects

For optimal results, implement the interrupted time-series design: O₁ O₂ O₃ O₄ O₅ X O₆ O₇ O₈ O₉ O₁₀, where O represents observation timepoints and X represents Cbei_2176 manipulation . This design allows for robust assessment of phenotypic changes attributable to Cbei_2176 function while controlling for temporal trends and background effects.

How does Cbei_2176 potentially contribute to butanol production pathways in engineered Clostridium beijerinckii strains?

While direct evidence for Cbei_2176's role in butanol production is limited in the available literature, we can infer potential contributions based on its membrane localization and research on related engineered C. beijerinckii strains. Membrane proteins often play crucial roles in solvent tolerance, substrate transport, and stress response mechanisms during solventogenesis.

Recent research on engineered C. beijerinckii strains demonstrates that genetic modifications can significantly enhance butanol production. For example, a recombinant strain expressing methylglyoxal synthase and methylglyoxal reductase produced 87% more butanol on lactose than control strains . This improvement was associated with transcriptomic changes affecting:

  • Lactose uptake and catabolism

  • Iron uptake systems

  • Signal transduction mechanisms

  • Vitamin biosynthesis pathways

  • Amino acid metabolism

As a membrane protein, Cbei_2176 may contribute to butanol production through:

  • Facilitating butanol export to reduce intracellular toxicity

  • Modulating membrane permeability during solventogenesis

  • Participating in stress response mechanisms during solvent production

  • Contributing to substrate uptake or nutrient transport

To investigate these potential roles, researchers should design experiments that:

  • Measure butanol production in Cbei_2176 knockout vs. wild-type strains

  • Perform transcriptomic analysis comparing expression before and during solventogenesis

  • Analyze membrane integrity and composition in strains with varying Cbei_2176 expression levels

  • Conduct proteomic analysis to identify protein-protein interactions involving Cbei_2176

These approaches would provide insights into whether Cbei_2176 represents a potential target for future engineering of C. beijerinckii strains to improve butanol production on various substrates, including lactose and whey permeate .

What purification strategies are most effective for obtaining high-purity Cbei_2176 for structural studies?

Obtaining high-purity Cbei_2176 presents significant challenges due to its membrane-associated nature. Based on established protocols for membrane protein purification, the following methodological approach is recommended:

  • Affinity chromatography: Utilize His-tag fusion for initial capture

    • Immobilized metal affinity chromatography (IMAC) with Ni²⁺ or Co²⁺ resins

    • Gradient elution with imidazole (20-500 mM)

    • Buffer optimization to maintain protein stability

  • Detergent selection: Critical for solubilization while maintaining native conformation

    • Screen mild detergents: n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG)

    • Consider protein-lipid interactions using lipid nanodiscs or amphipols for stability

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates and achieve monodispersity

    • Ion exchange chromatography for removing contaminants with different charge properties

For structural studies such as X-ray crystallography or cryo-electron microscopy, protein purity should exceed 95% as determined by SDS-PAGE . Consider the following purity assessment protocol:

  • SDS-PAGE analysis with Coomassie staining

  • Western blot validation using anti-His antibodies

  • Mass spectrometry to confirm protein identity and assess modifications

  • Dynamic light scattering to evaluate sample homogeneity

The purified protein should be maintained in a stabilizing buffer, potentially incorporating appropriate detergents or lipids to preserve native conformation, particularly for structural studies requiring functional protein.

How can researchers effectively apply quasi-experimental designs to assess the effects of Cbei_2176 manipulation?

Quasi-experimental designs offer robust frameworks for studying Cbei_2176 function when randomized controlled trials are not feasible. These approaches are particularly valuable for analyzing temporal effects of gene expression or protein activity in complex biological systems.

When studying Cbei_2176, consider these quasi-experimental design strategies:

  • Interrupted time-series design with multiple measurement points:

    • Collect data at equal time intervals before and after Cbei_2176 manipulation

    • Notation: O₁ O₂ O₃ O₄ O₅ X O₆ O₇ O₈ O₉ O₁₀

    • Benefits: Controls for secular trends, seasonal effects, and maturation

  • The removed-treatment design:

    • Measure baseline, implement Cbei_2176 manipulation, measure effect, remove manipulation, measure again

    • Notation: O₁ X O₂ O₃ removeX O₄

    • Benefits: Demonstrates reversibility of effects and strengthens causal inference

  • Untreated control group design with dependent pretest and posttest samples:

    • Intervention group: O₁ₐ X O₂ₐ

    • Control group: O₁ᵦ O₂ᵦ

    • Benefits: Controls for history effects and selection bias

When implementing these designs, researchers should:

  • Define clear, measurable outcomes related to Cbei_2176 function

  • Control for confounding variables through careful experimental setup

  • Ensure sufficient statistical power through appropriate sample sizing

  • Use appropriate statistical analyses for interrupted time series data

These quasi-experimental approaches provide structured frameworks for investigating how Cbei_2176 manipulation affects cellular metabolism, stress response, or membrane function in C. beijerinckii, even when classical randomized experimental designs are impractical.

What strategies can researchers use to interpret transcriptomic data related to Cbei_2176 expression in different growth conditions?

Interpreting transcriptomic data for Cbei_2176 requires sophisticated analytical approaches that account for the complex regulatory networks in C. beijerinckii. Based on recent transcriptomic characterization of recombinant C. beijerinckii strains , researchers should implement the following analytical framework:

  • Normalization and differential expression analysis:

    • Apply appropriate normalization methods (TPM, RPKM, or DESeq2 normalization)

    • Establish stringent statistical thresholds (adjusted p-value < 0.05, log₂ fold change > 1)

    • Validate key findings using RT-qPCR for selected genes

  • Co-expression network analysis:

    • Identify genes with expression patterns correlated with Cbei_2176

    • Construct weighted gene co-expression networks to identify functional modules

    • Infer potential regulatory relationships

  • Integration with metabolic pathways:

    • Map expression changes to known metabolic pathways in C. beijerinckii

    • Focus on pathways related to membrane function, solvent production, and stress response

    • Identify metabolic bottlenecks or enhanced pathways

  • Comparative analysis across conditions:

    • Compare expression profiles across different carbon sources (e.g., glucose vs. lactose)

    • Analyze temporal expression patterns during growth phases

    • Examine expression changes under stress conditions

Recent transcriptomic studies of engineered C. beijerinckii strains demonstrated significant differences in expression patterns, including widespread decreases in Fe-S proteins coupled with increased expression of genes involved in lactose metabolism, iron uptake, and signal transduction . These findings suggest complex regulatory networks that may involve membrane proteins like Cbei_2176.

To interpret such data effectively, researchers should:

  • Account for the broader metabolic context, including potential roles in solventogenesis

  • Consider post-transcriptional regulation that may affect protein abundance

  • Validate key findings with complementary approaches (proteomics, metabolomics)

  • Use statistical approaches appropriate for time-series transcriptomic data

These strategies will enable researchers to derive meaningful insights from transcriptomic data related to Cbei_2176 expression and its potential roles in C. beijerinckii metabolism and adaptation.

What are the key considerations for designing gene knockout experiments to study Cbei_2176 function?

Designing effective gene knockout experiments for Cbei_2176 requires careful consideration of both technical and biological factors. Based on established methodologies for genetic manipulation of Clostridium species, researchers should address the following key considerations:

  • Knockout strategy selection:

    • CRISPR-Cas9 system: Design guide RNAs targeting specific regions of Cbei_2176 with minimal off-target effects

    • Homologous recombination: Design constructs with appropriate homology arms (>500 bp) flanking Cbei_2176

    • Antisense RNA: Design antisense constructs for transient knockdown if complete knockout is lethal

  • Validation of knockout efficiency:

    • PCR verification of genomic modifications

    • RT-qPCR to confirm absence of Cbei_2176 transcripts

    • Western blotting to verify protein absence

    • Whole genome sequencing to confirm single-site modification without off-target effects

  • Phenotypic characterization protocol:

    • Growth kinetics in various media compositions

    • Membrane integrity assessment

    • Metabolite profiling with focus on butanol and other solvents

    • Stress response characterization (solvent tolerance, pH tolerance)

  • Complementation strategy:

    • Plasmid-based expression of wild-type Cbei_2176 in knockout strain

    • Inducible expression systems to control complementation timing

    • Site-directed mutagenesis to identify critical functional residues

The experimental design should incorporate appropriate controls and sufficient biological replicates to ensure statistical reliability. Researchers should be aware that membrane protein knockouts may have pleiotropic effects that complicate interpretation. Consider implementing interrupted time-series experimental designs to capture dynamic phenotypic changes following gene knockout .

How can researchers leverage Google's People Also Ask data to enhance Cbei_2176 research visibility?

Utilizing Google's People Also Ask (PAA) data represents a strategic approach to enhance the visibility and impact of Cbei_2176 research. PAA data provides valuable insights into search behaviors and knowledge gaps that can inform both research direction and communication strategies.

Google's PAA feature appears in over 80% of English searches, generally within the first few results . For researchers working with specialized topics like Cbei_2176, understanding and leveraging PAA data offers several methodological advantages:

  • Research question refinement:

    • Identify knowledge gaps through PAA questions related to Clostridium membrane proteins

    • Recognize emerging research interests in the field

    • Refine experimental questions to address common queries

  • Content optimization strategy:

    • Structure research publications to directly address common PAA questions

    • Include keywords and phrases that align with typical search patterns

    • Develop supplementary materials addressing frequent questions

  • Implementation approach:

    • Regularly search for your research topic and note PAA questions

    • Click on relevant PAA questions to reveal additional cascading questions

    • Analyze question patterns to identify knowledge gaps and research opportunities

PAA data can reveal interconnected questions that may not be obvious within specialized research communities. For example, PAA questions about Clostridium beijerinckii may reveal connections between membrane proteins and metabolic engineering for improved butanol production that could inform new research directions .

When publishing research on Cbei_2176, consider:

This approach enhances research visibility by aligning scientific communication with actual search behaviors, potentially increasing citations and research impact.

What are the most promising applications of Cbei_2176 research in biofuel production?

Research on Cbei_2176 holds significant potential for advancing biofuel production, particularly in the context of butanol biosynthesis by Clostridium beijerinckii. While direct evidence for Cbei_2176's role in butanol production pathways is still emerging, several promising applications can be inferred from the broader context of recombinant C. beijerinckii research.

Recent studies demonstrate that engineered C. beijerinckii strains can achieve significantly improved butanol production, with one recombinant strain producing 87% more butanol on lactose than the control strain . As a membrane protein, Cbei_2176 may contribute to this process through several mechanisms:

  • Substrate utilization enhancement:

    • Potential role in lactose or whey permeate uptake systems

    • Contribution to efficient carbon source metabolism

    • Involvement in cellular signaling related to substrate availability

  • Butanol tolerance mechanisms:

    • Modulation of membrane permeability during solventogenesis

    • Participation in stress response pathways

    • Potential role in solvent export or detoxification

  • Metabolic flux optimization:

    • Contribution to redox balance maintenance

    • Potential roles in electron transport chains

    • Involvement in metabolic regulation during solventogenesis

Future research directions should focus on:

  • Direct experimental evidence for Cbei_2176's role in butanol production

  • Structure-function relationships to identify critical domains

  • Engineering modified versions with enhanced functionality

  • Integration with other genetic modifications for synergistic improvements

These investigations could ultimately lead to the development of improved C. beijerinckii strains with enhanced capabilities for converting agricultural waste streams, such as whey permeate, into valuable biofuels like butanol.

What challenges remain in fully characterizing the structural and functional properties of Cbei_2176?

Despite advances in recombinant protein technology, several significant challenges remain in fully characterizing Cbei_2176 at structural and functional levels. These challenges represent important areas for future methodological development:

  • Structural characterization challenges:

    • Obtaining sufficient quantities of properly folded protein for crystallography or cryo-EM

    • Maintaining membrane protein stability during purification and analysis

    • Determining the native oligomeric state in the membrane environment

    • Resolving dynamic structural changes during function

  • Functional characterization barriers:

    • Limited genetic tools for precise manipulation in Clostridium beijerinckii

    • Difficulty in establishing direct biochemical assays for membrane protein function

    • Complex interactions with other membrane components

    • Potential redundancy in function with other membrane proteins

  • Methodological limitations:

    • Challenges in implementing reporter systems in anaerobic bacteria

    • Limited availability of antibodies or specific ligands for Cbei_2176

    • Difficulties in reconstituting functional membrane proteins in artificial systems

    • Complexity of interpreting phenotypic changes in knockout strains

Addressing these challenges will require innovative approaches combining:

  • Advanced structural biology techniques adapted for membrane proteins

  • Development of specialized genetic tools for Clostridium species

  • Novel functional assays sensitive enough to detect membrane protein activities

  • Integrated multi-omics approaches to capture complex cellular responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.