Recombinant Clostridium botulinum Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Cobalamin Synthase (CobS) in Bacterial Systems

CobS is a critical enzyme in the nucleotide loop assembly (NLA) pathway of cobalamin (vitamin B12) biosynthesis. It catalyzes the final steps of adenosylcobalamin synthesis by joining adenosylcobinamide-GDP and α-ribazole-5′-phosphate to form adenosylcobalamin-5′-phosphate, which is later dephosphorylated to active cobalamin .

Key Features of CobS:

  • Substrates: Requires adenosylcobinamide-GDP (from CobU) and α-ribazole-5′-phosphate (from CobT) .

  • Function: Acts as a cobalamin-5′-phosphate synthase, facilitating the attachment of the lower ligand (e.g., dimethylbenzimidazole) to the corrin ring .

  • Cofactors: GTP-dependent activity observed in Salmonella typhimurium .

Comparative Analysis of CobS Across Species

OrganismCobS FunctionUnique Properties
Salmonella typhimuriumSynthesizes adenosylcobalamin-5′-phosphate from adenosylcobinamide-GDP and α-ribazole-5′-P .Requires CobC phosphatase for final dephosphorylation .
Vibrio choleraeExhibits dual functionality: salvages cobinamide and remodels pseudocobalamin .Directly remodels pseudocobalamin to cobalamin without intermediate steps .
Escherichia coliLimited to cobinamide salvaging; lacks pseudocobalamin remodeling activity .CobS activity depends on coexpression with CobC and PspA to mitigate toxicity .

Recombinant CobS Expression Challenges

  • Toxicity: Overexpression of CobS in E. coli collapses cellular energy charge, necessitating coexpression with CobC (phosphatase) and PspA (phage shock protein) for viability .

  • Activity: Recombinant CobS from S. typhimurium and V. cholerae has been successfully purified and assayed in vitro, confirming its role in cobalamin-5′-phosphate synthesis .

Hypothetical Insights for Clostridium botulinum

While no direct studies on C. botulinum CobS are available, its cobalamin biosynthesis pathway likely follows conserved microbial mechanisms:

  1. Cobalt Insertion: Clostridium species may use anaerobic pathways for early cobalt insertion into the corrin ring .

  2. Nucleotide Loop Assembly: CobS would function similarly to Salmonella and Vibrio homologs, requiring CobT (ribosyltransferase) and CobU (guanylyltransferase) for substrate synthesis .

Research Gaps and Opportunities

  • Structural Studies: No crystal structures of Clostridium CobS are reported. Homology modeling using S. typhimurium CobS (PDB: unavailable) could provide mechanistic insights.

  • Applications: Recombinant C. botulinum CobS could enhance microbial cobalamin production or enable engineered pathways for industrial B12 synthesis.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; CLL_A2922; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Clostridium botulinum (strain Eklund 17B / Type B)
Target Names
cobS
Target Protein Sequence
MKNLFKGLMMSLSMFTIIPMPYVEWDEDGAKNMMKCYPIIGLIVGCVWFLGYKLINYLNI SIVLKSALIMIIPFIITGMLHLDGFMDVCDAILSRRDKEEKLRILKDSTTGAFSVISVII LFFIQFGAVHSFLEYNKNPYILMFLPIISRNIVAYFFITIITIKESTLGSYFTKGTNIKD KVILILELALVCILFGIILGYIGIVILLIVTVAISLCVKKCINEFGGISGDVAGFSLVVG ELVGLFSACLFT
Uniprot No.

Target Background

Function
Catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and alpha-ribazole. Additionally, it synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is cobalamin synthase (cobS) and what is its role in C. botulinum?

Cobalamin synthase (cobS) is a critical enzyme in the vitamin B12 (cobalamin) biosynthetic pathway of C. botulinum. It catalyzes the attachment of the upper axial ligand to the cobalt atom in the corrin ring structure during the late stages of cobalamin synthesis. In C. botulinum, cobS functions within an anaerobic biosynthetic pathway, as the organism is a strict anaerobe. The enzyme is part of a complex cobS operon that includes several genes involved in the assembly of the corrin ring structure.

The role of cobS is particularly important because cobalamin serves as a cofactor for various essential metabolic processes in C. botulinum, including methionine synthesis and maintaining proper cellular function. Moreover, cobalamin availability may influence toxin production, as vitamin B12 has been shown to affect microbial composition and metabolic activities in other bacterial species . Research with related Clostridium species has demonstrated that the biosynthesis of complex molecules like cobalamin requires specific genetic elements that are often conserved across the genus.

How does the genetic organization of the cobS region differ across C. botulinum strains?

The genetic organization of the cobS region varies among different C. botulinum strains, particularly between the distinct toxinotypes (A through G). This variation parallels the genetic diversity observed in toxin genes and their surrounding regions. The cobS gene typically exists within a complex operon structure that includes other cob genes involved in cobalamin synthesis.

In some C. botulinum strains, particularly those of toxinotypes C and D, the cobS gene is located in relative proximity to regions that also encode toxin-associated genes . Genomic analyses have revealed that horizontal gene transfer events have shaped the current genetic landscape in C. botulinum, resulting in strain-specific differences in the organization of metabolic genes including cobS.

Comparative genomic studies show that while the core catalytic domains of cobS are well conserved across strains, the regulatory regions upstream of the gene can differ significantly. These differences may contribute to varied expression levels of cobS and, consequently, differing cobalamin synthesis capacities among strains. The genetic context of cobS appears particularly important when considering its potential indirect effects on toxin production through metabolic regulation.

What techniques are commonly used to isolate and characterize recombinant cobS from C. botulinum?

Isolation and characterization of recombinant cobS from C. botulinum typically involves a multi-step process using techniques adapted for working with anaerobic, potentially toxigenic organisms. The methodology must account for the biosafety considerations associated with C. botulinum.

For gene isolation, researchers commonly employ PCR amplification using primers designed based on available genomic sequences. Following amplification, the cobS gene is typically cloned into appropriate expression vectors. Due to the challenges associated with directly working with C. botulinum, recombinant cobS is often expressed in heterologous host systems, similar to approaches used for neurotoxin studies .

The characterization process typically includes:

  • Sequence verification using standard DNA sequencing methods

  • Protein expression analysis using SDS-PAGE and Western blotting

  • Enzyme activity assays to measure cobS functionality

  • Structural characterization through techniques such as circular dichroism or X-ray crystallography

For genomic DNA extraction from C. botulinum, protocols similar to those used for C. tetani may be employed, including treatment with lysozyme, proteinase K, and phenol-chloroform extraction . For example, a typical extraction procedure might involve:

  • Growth of C. botulinum in appropriate anaerobic media

  • Cell collection by centrifugation

  • Resuspension in buffer containing RNase A and lysozyme

  • Treatment with SDS and proteinase K

  • DNA purification using phenol-chloroform extraction

  • Precipitation with ethanol and resuspension in appropriate buffer

All work with C. botulinum must adhere to strict biosafety protocols and may require specific approvals from institutional biosafety committees, particularly for recombinant DNA work involving toxin genes .

How does cobalamin synthesis interact with neurotoxin production regulatory networks in C. botulinum?

The relationship between cobalamin synthesis and neurotoxin production in C. botulinum involves complex regulatory networks that are still being elucidated. Current research suggests several potential interaction points between these pathways:

First, both cobalamin synthesis and neurotoxin production are influenced by environmental and nutritional factors. Regulatory elements such as riboswitches have been identified in cobalamin metabolism genes in various bacteria, which respond to cobalamin concentrations by altering gene expression . Similar to how cobalamin riboswitches can regulate B12 transporters in other organisms, it's possible that metabolic changes resulting from altered cobalamin synthesis in C. botulinum could indirectly impact toxin gene expression.

Second, both pathways may share common regulatory proteins or respond to similar environmental cues. The tetR regulatory system, which has been studied in C. tetani for neurotoxin expression , may have homologs in C. botulinum that affect both toxin production and metabolic pathways like cobalamin synthesis.

Third, experimental evidence from related studies suggests that vitamin B12 supplementation can significantly alter microbial metabolism. For instance, methylcobalamin supplementation has been shown to promote lipid, terpenoid, and polyketide metabolism in gut bacteria while inhibiting the synthesis of transcription factors and secondary metabolites . This metabolic reprogramming could potentially influence toxin production in C. botulinum.

The precise mechanisms linking these pathways remain an active area of research, with potential implications for understanding botulism pathogenesis and developing novel intervention strategies.

What are the challenges in expressing functional recombinant C. botulinum cobS in heterologous expression systems?

Expressing functional recombinant C. botulinum cobS in heterologous systems presents several significant challenges:

  • Protein solubility and folding: Cobalamin synthases are typically large, complex proteins that may not fold properly in heterologous hosts. The anaerobic native environment of C. botulinum creates specific redox conditions that may be difficult to replicate in common expression hosts.

  • Cofactor requirements: CobS requires specific cofactors for activity, including cobalamin precursors and potentially other proteins from the cobalamin biosynthetic pathway. Ensuring availability of these cofactors in heterologous systems can be challenging.

  • Codon usage bias: The significant difference in codon usage between C. botulinum and common expression hosts like E. coli can lead to translational stalling and reduced protein yield. Codon optimization may be necessary but can sometimes affect protein folding.

  • Toxicity concerns: Expression of clostridial proteins in heterologous hosts can sometimes result in toxicity to the host cells, limiting growth and protein production. This has been observed with certain components of the neurotoxin complex .

  • Anaerobic expression requirements: As C. botulinum is a strict anaerobe, proper folding and activity of cobS may require anaerobic expression conditions, which are technically challenging to implement in standard laboratory settings.

These challenges can be addressed through various strategies, including the use of specialized expression vectors, co-expression of chaperones, expression in anaerobic hosts, and engineering fusion proteins to enhance solubility. Experience with recombinant toxin expression in C. tetani and C. botulinum systems suggests that optimizing media composition, such as using modified Mueller Miller media, could enhance the stability of recombinant proteins.

How do mutations in cobS affect cobalamin synthesis pathways and cellular metabolism in C. botulinum?

Mutations in the cobS gene can have cascading effects on cobalamin synthesis pathways and broader cellular metabolism in C. botulinum. Based on studies of cobalamin metabolism in related organisms, several consequences may be anticipated:

Null mutations that eliminate cobS activity would likely result in an inability to complete the cobalamin biosynthesis pathway, leading to vitamin B12 deficiency within the cell. This deficiency would impact multiple metabolic pathways that depend on cobalamin as a cofactor, including methionine synthesis and methylmalonyl-CoA mutase activity, potentially altering the cell's ability to utilize certain carbon sources.

Point mutations affecting the catalytic efficiency of cobS might result in reduced cobalamin synthesis, creating a partial deficiency state. Such mutations could lead to the accumulation of pathway intermediates, potentially triggering regulatory responses through riboswitch mechanisms . The accumulation of certain intermediates might also have toxic effects on the cell.

Studies on cobalamin supplementation in microbial communities have demonstrated significant shifts in bacterial metabolism and composition . By extension, defects in endogenous cobalamin synthesis in C. botulinum would likely trigger compensatory metabolic adaptations, potentially altering growth characteristics, stress responses, and possibly virulence factor production.

What are the optimal conditions for expressing recombinant C. botulinum cobS?

The optimal conditions for expressing recombinant C. botulinum cobS depend on the expression system chosen, but several parameters have been found to be critical based on experience with other clostridial recombinant proteins:

For expression in E. coli or other aerobic hosts:

  • Use of specialized expression vectors containing promoters that allow tight regulation (such as T7 or tac promoters)

  • Growth at lower temperatures (16-25°C) after induction to improve protein folding

  • Addition of specific cofactors to the growth medium

  • Use of E. coli strains engineered for expression of proteins with rare codons (like Rosetta or CodonPlus strains)

  • Inclusion of solubility-enhancing fusion partners such as MBP or SUMO

For expression in Clostridium species (homologous or heterologous):

  • Use of shuttle vectors compatible with Clostridium, such as the pMTL series vectors used for C. tetani

  • Careful selection of promoters, with the tetR promoter system showing efficacy in clostridial species

  • Growth in specialized media such as modified Mueller Miller media, which has been shown to enhance stability of recombinant proteins in Clostridium species

  • Strict anaerobic conditions maintained throughout the cultivation process

  • Harvest timing optimized to coincide with maximal expression, typically in late logarithmic phase

Regardless of the expression system, it's essential to verify the functionality of the recombinant cobS through activity assays. For clostridial expression systems, protocols similar to those used for recombinant neurotoxin expression can be adapted, including growth in TPGY liquid media followed by appropriate cell harvesting and protein extraction procedures .

How can enzymatic activity of recombinant cobS be accurately measured?

Measuring the enzymatic activity of recombinant cobS requires specialized assays that account for the complex nature of the cobalamin synthesis reaction. Several methodological approaches can be employed:

Direct enzymatic assays:

  • Radioisotope incorporation assays using 57Co or 14C-labeled substrates to track the incorporation of the upper axial ligand

  • HPLC or LC-MS-based assays to detect the conversion of substrate to product

  • Spectrophotometric assays monitoring changes in absorbance during the reaction

Coupled enzyme assays:

  • Systems that link cobS activity to a more easily detectable enzymatic reaction

  • Reconstitution of partial cobalamin synthesis pathways in vitro

In vivo complementation assays:

  • Expression of recombinant cobS in cobalamin synthesis-deficient bacterial strains

  • Measurement of restored cobalamin production or cobalamin-dependent growth

A typical protocol might involve:

  • Purification of recombinant cobS using affinity chromatography

  • Preparation of substrate (hydrogenobyrinic acid a,c-diamide or precorrin intermediates)

  • Incubation under anaerobic conditions with appropriate cofactors

  • Analysis of reaction products using HPLC or LC-MS

  • Quantification of activity based on product formation rates

When developing such assays, it's important to consider the potential influence of different forms of cobalamin on the assay results, as methylcobalamin and cyanocobalamin have been shown to have different effects on bacterial metabolism .

What safety protocols should be followed when working with recombinant C. botulinum proteins?

Working with recombinant C. botulinum proteins, especially those related to toxin production or metabolism, requires strict adherence to biosafety protocols:

Regulatory compliance:

  • All recombinant DNA work involving C. botulinum genes must be approved by the Institutional Biosafety Committee (IBC)

  • Work involving toxin genes may require additional approvals from agencies such as the Division of Select Agents and Toxins at the CDC

  • A Dual Use Research of Concern (DURC) risk mitigation plan may be necessary for certain experiments

Laboratory containment requirements:

  • Minimum containment level of BSL-2 for work with non-toxigenic components

  • BSL-3 facilities for work with toxigenic strains or toxin components

  • Strict adherence to anaerobic working protocols

Personal protective equipment:

  • Laboratory coat, gloves, and eye protection as standard

  • Additional PPE as specified by institutional guidelines for work with select agents

Waste management:

  • Proper decontamination of all materials that contact C. botulinum or its components

  • Autoclave sterilization of solid waste

  • Chemical disinfection of liquid waste

Emergency procedures:

  • Established protocols for accidental exposures or spills

  • Availability of botulinum antitoxin for high-risk work environments

Documentation requirements:

  • Detailed record-keeping of all experiments

  • Inventory control for all C. botulinum strains and derived materials

  • Regular reporting to institutional oversight committees

These safety protocols are particularly important given the extreme toxicity of botulinum neurotoxins, which are classified as category A biothreat agents by the United States Center of Disease Control and Prevention .

How can genomic manipulation techniques be applied to study cobS function in C. botulinum?

Genomic manipulation techniques offer powerful approaches to study cobS function in C. botulinum, though they present technical challenges due to the organism's anaerobic nature and biosafety considerations. Several methodologies can be employed:

Gene knockout/knockdown strategies:

  • Homologous recombination-based approaches using suicide vectors

  • CRISPR-Cas9 systems adapted for anaerobic clostridia

  • Antisense RNA strategies for gene silencing

  • Group II intron-based systems (e.g., ClosTron) that have been successful in other Clostridium species

Complementation studies:

  • Expression of wildtype or mutant cobS variants in knockout strains

  • Use of inducible promoters to control expression levels

  • Expression of cobS from different C. botulinum strains to study strain-specific differences

Reporter gene assays:

  • Fusion of cobS promoter regions to reporter genes like gusA or fluorescent proteins

  • Monitoring of gene expression under various conditions to understand regulation

Transcriptomic approaches:

  • RNA-seq analysis of wildtype versus cobS mutant strains

  • Identification of genes co-regulated with cobS

  • Mapping of the cobalamin regulon in C. botulinum

A typical experimental workflow might involve:

  • Design and construction of knockout vectors targeting the cobS gene

  • Transfer of these vectors into C. botulinum through conjugation or electroporation

  • Selection and verification of mutants

  • Phenotypic characterization including growth curves, metabolomics, and toxin production analysis

  • Complementation with functional cobS to confirm phenotype specificity

When extracting genomic DNA for manipulation or verification, protocols similar to those used with C. tetani can be adapted, involving careful lysis with enzymes like lysozyme and proteinase K, followed by phenol-chloroform extraction .

How does cobalamin synthesis in C. botulinum relate to toxin production and virulence?

The relationship between cobalamin synthesis and toxin production in C. botulinum represents an important intersection of metabolism and virulence. Several lines of evidence suggest potential connections:

Metabolic regulation of toxin production has been observed in C. botulinum, where nutritional status influences toxin gene expression. Cobalamin, as an essential cofactor for several metabolic processes, may indirectly influence this regulation. When cobalamin availability changes, it could trigger broad metabolic shifts that affect the energy and resources available for toxin synthesis.

Different forms of cobalamin (cyanocobalamin versus methylcobalamin) have been shown to have distinct effects on bacterial metabolism in other systems . Methylcobalamin has been observed to promote lipid, terpenoid, and polyketide metabolism while inhibiting the synthesis of transcription factors and secondary metabolites . Such metabolic reprogramming could potentially influence toxin production pathways in C. botulinum.

Cobalamin riboswitches, which are regulatory RNA elements that respond to cobalamin concentrations, can control the expression of genes related to B12 metabolism . If similar regulatory mechanisms exist in C. botulinum, they might create links between cobalamin synthesis and other cellular processes, including potentially toxin production.

Some evidence from related research on recombinant neurotoxin expression suggests that media composition can significantly affect toxin stability . The modified Mueller Miller media, which enhanced the stability of recombinant CNTs, might also influence cobalamin synthesis and the relationship between these pathways.

The connections between these processes remain an active area of research, with potential implications for understanding botulism pathogenesis and developing intervention strategies.

What are the implications of cobS research for developing new diagnostic tools for botulism?

Research on cobS and the cobalamin synthesis pathway in C. botulinum has several potential implications for developing new diagnostic approaches for botulism:

Molecular diagnostic targets:
The cobS gene and its regulatory elements could serve as additional molecular targets for PCR-based detection of C. botulinum in clinical or environmental samples. Current diagnostic methods already employ PCR assays targeting toxin genes , and adding metabolic markers like cobS could improve specificity or sensitivity.

Metabolic biomarkers:
Alterations in cobalamin metabolism resulting from C. botulinum infection might create detectable metabolic signatures in host tissues or fluids. These signatures could potentially be developed into biomarkers for early detection of botulism, addressing current challenges in timely diagnosis.

Riboswitch-based biosensors:
Cobalamin riboswitches, which respond to B12 concentrations, could potentially be engineered into biosensor systems for detecting C. botulinum metabolic activity in samples. Similar RNA-based sensors have been developed for other bacterial pathogens.

Differential diagnosis:
Understanding the metabolic differences between C. botulinum and other clostridia could help in differentiating botulism from other clostridial diseases. This is particularly relevant for toxinotypes C, D, C/D, and D/C, which are important in veterinary medicine .

Current diagnostics for botulism rely primarily on mouse bioassays (MBA) and PCR methods , with sample collection timing being critical—serum should be collected at the onset of clinical signs before antitoxin administration . Expanding the molecular toolkit to include metabolic markers like cobS could potentially address some limitations of current approaches, particularly in cases where toxin detection is challenging.

What are the most promising future research directions for recombinant C. botulinum cobS studies?

Research on recombinant C. botulinum cobS holds significant potential for advancing both basic science and applied fields. Several promising future directions include:

Structural biology approaches:
Determining the crystal structure of C. botulinum cobS would provide invaluable insights into its catalytic mechanism and potential differences from cobS enzymes in other organisms. This structural information could guide the design of specific inhibitors targeting the clostridial enzyme.

Systems biology integration:
Investigating the role of cobS within the broader metabolic network of C. botulinum through omics approaches would help elucidate how cobalamin synthesis intersects with other cellular processes, including toxin production. This systems-level understanding could reveal new regulatory nodes that influence virulence.

Comparative studies across strains:
Analyzing cobS sequence, expression, and activity across diverse C. botulinum strains could reveal strain-specific adaptations in cobalamin metabolism. Particular emphasis on differences between highly toxigenic and less toxigenic strains might uncover metabolic factors that influence virulence potential.

Development of cobS-based countermeasures:
Exploring the potential of cobS inhibitors as novel therapeutic agents against botulism represents an alternative approach to current immunotherapeutic strategies . Targeting metabolic vulnerabilities could complement existing antitoxin approaches.

Engineered expression systems:
The development of optimized expression systems for recombinant cobS could facilitate large-scale production of the enzyme for structural and functional studies. Experience with recombinant neurotoxin expression in C. tetani provides a foundation for developing similar systems for cobS.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.