Recombinant Clostridium botulinum Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Description

Recombinant Clostridium botulinum Potassium-Transporting ATPase C Chain (kdpC): Overview

The kdpC subunit is a component of the KdpFABC complex, a high-affinity P-type ATPase responsible for potassium (K⁺) transport in Clostridium botulinum. This chimeric system combines ATP hydrolysis (via KdpB) with channel-like K⁺ translocation (via KdpA), with KdpC and KdpF stabilizing the complex and modulating its activity. Recombinant kdpC is produced in E. coli or other systems for structural, functional, and vaccine-related studies .

Functional Significance of kdpC in the KdpFABC Complex

kdpC plays critical roles in K⁺ transport and ATPase coupling:

  1. Substrate Affinity Modulation:

    • Enhances high-affinity K⁺ binding by interacting with conserved residues in KdpA and KdpB .

    • May act as a catalytic chaperone, ensuring proper ion conduction through the intersubunit tunnel .

  2. Structural Stabilization:

    • Anchors the KdpF subunit (a single transmembrane helix) to the core KdpA-KdpB complex .

    • Maintains the integrity of the transmembrane tunnel for K⁺ translocation .

Mechanism of Ion Transport

The KdpFABC complex operates via an alternating-access mechanism:

  1. K⁺ Binding: Ions bind to the selectivity filter (SF) in KdpA, dehydrated and guided through a tunnel spanning KdpA and KdpB .

  2. ATP Hydrolysis: KdpB’s phosphorylation domain (P-domain) couples ATP hydrolysis to conformational changes, driving K⁺ efflux .

  3. Role of kdpC: Stabilizes the E1·ATP state and facilitates coordination between KdpA and KdpB during ion translocation .

Key Residues and Mutational Studies

  • Arg493 (KdpA) and Asp583 (KdpB): Critical for tunnel integrity and coupling ATP hydrolysis to K⁺ transport .

  • Glu370: Part of a conserved proton wire proposed to regulate charge compensation during transport .

Applications of Recombinant kdpC

ApplicationDetailSource
Vaccine DevelopmentUsed as a subunit vaccine antigen to target C. botulinum in veterinary settings
Structural StudiesCryo-EM and X-ray crystallography to resolve KdpFABC architecture
Functional AssaysTesting ion selectivity and ATPase activity in vitro

Challenges and Future Directions

  1. Structural Gaps: Limited high-resolution data for C. botulinum-specific kdpC. Current insights derive from homologs (e.g., E. coli KdpFABC) .

  2. Evolutionary Insights: Phylogenetic analysis of kdpC in C. botulinum strains could reveal niche-specific adaptations (e.g., gut colonization) .

  3. Therapeutic Potential: Exploring kdpC as a target for antimicrobial agents disrupting K⁺ homeostasis in pathogens .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
kdpC; CLH_0917; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Clostridium botulinum (strain Alaska E43 / Type E3)
Target Names
kdpC
Target Protein Sequence
MKEFKAVFPKALIIFIIFTILCGGIYTIFITGISQLIFPKQANGSIIEVNGKKYGSVLLA QQYNDEKHLWGRIMNIDTNTFVDENGKKLAYSAPSNLSPASKEYEALVQERVDKIKENHP EQDEQAIPVDLVTCSGSGLDPHISVAAAKYQINRIAKNNNMEVKDVENIIDKYTSGKLFG VLGEKTVNVLEVNLAIDGILK
Uniprot No.

Target Background

Function

The recombinant Clostridium botulinum Potassium-transporting ATPase C chain (KdpC) is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. KdpC acts as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links

KEGG: cbt:CLH_0917

Protein Families
KdpC family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the kdpC protein in Clostridium botulinum and what is its functional significance?

The kdpC protein in Clostridium botulinum is a critical component of the high-affinity potassium transport system (Kdp-ATPase complex). It functions as part of the KdpFABC operon, which encodes a P-type ATPase responsible for potassium ion uptake under potassium-limited conditions. In Clostridium botulinum, as in other bacteria, the kdpC subunit plays an essential role in maintaining potassium homeostasis, which is crucial for various cellular processes including maintenance of turgor pressure, regulation of cytoplasmic pH, and enzyme activation. The protein is particularly important during environmental stress conditions when potassium becomes limited, making it a potential target for understanding bacterial survival mechanisms in adverse conditions.

How does kdpC expression relate to virulence and toxin production in Clostridium botulinum?

The relationship between kdpC expression and virulence in C. botulinum involves complex regulatory networks affecting potassium homeostasis and stress responses. Research indicates that potassium transport systems including kdpC may influence toxin production through multiple mechanisms. Studies have shown that environmental conditions that induce stress responses in C. botulinum, such as nutrient limitation or pH changes, can simultaneously affect both potassium transport systems and toxin expression pathways . For example, acidic conditions (pH between ~6.5 and 8.0) significantly impact toxin stability and production, with extracellular metalloproteases potentially degrading botulinum neurotoxin (BoNT) at specific pH ranges . The kdpC expression appears to respond to these same environmental cues, suggesting interrelated regulatory mechanisms. Furthermore, potassium limitation can trigger stress responses that may cross-regulate with pathways controlling neurotoxin production, though direct causative relationships require further investigation.

What is the genetic organization of the kdp operon in Clostridium botulinum strains?

The kdp operon in Clostridium botulinum typically consists of four structural genes (kdpF, kdpA, kdpB, and kdpC) and two regulatory genes (kdpD and kdpE) that together form a two-component regulatory system. The operon structure follows a conserved pattern seen in many Gram-positive bacteria, though strain-specific variations exist. In C. botulinum Group II strains, which have been more extensively characterized using modern genetic tools, the operon maintains its core structure but shows some nucleotide sequence variations compared to Group I strains .

Gene expression analysis indicates that the operon functions as a coordinated unit, with all genes typically co-transcribed under potassium-limited conditions. The genomic context varies somewhat between different C. botulinum serotypes, with some strains showing additional genes in proximity that may influence regulation. Recent studies using CRISPR-Cas9 genome editing in C. botulinum Group II strains have enabled more precise characterization of these genetic elements and their functional relationships .

How do different C. botulinum strains vary in their kdpC sequence and expression patterns?

Significant variation exists in kdpC sequences and expression patterns across C. botulinum strains, particularly between different phylogenetic groups. Sequence alignment studies reveal approximately 75-85% sequence identity between Group I and Group II strains, with specific variations in transmembrane domains and cytoplasmic regions. These sequence differences correlate with functional adaptations to different environmental niches.

Expression analysis shows that Group I strains (proteolytic, mesophilic) exhibit different kdpC regulation patterns compared to Group II strains (non-proteolytic, psychrophilic). For instance, in Group II strains such as Beluga, Eklund 17B, and FT10F, kdpC expression is more responsive to cold stress, consistent with their ability to grow at refrigeration temperatures . In contrast, Group I strains like ATCC 3502 show stronger kdpC upregulation in response to osmotic stress and alkaline conditions.

The expression patterns also correlate with differences in growth media preferences, with certain media compositions (such as CMM-TPGY) significantly affecting gene expression profiles in specific strains . These variations highlight the importance of strain-specific considerations when designing experimental approaches for kdpC research.

What are the most effective methods for cloning and expressing recombinant kdpC from C. botulinum?

For successful cloning and expression of recombinant kdpC from C. botulinum, researchers should consider a multi-stage approach optimized for this challenging anaerobic pathogen. The most effective cloning strategy involves amplifying the kdpC gene using high-fidelity polymerase (such as KOD Hot-Start or Phusion) with primers designed to include appropriate restriction sites for downstream vector insertion . When designing constructs, incorporating a 20-30 bp homology arm on each side of the target insertion site significantly improves cloning efficiency.

  • Expression temperature reduction (16-18°C) to minimize inclusion body formation

  • Co-expression with chaperones (particularly GroEL/GroES system)

  • Inclusion of 1-2% glucose to reduce basal expression

  • IPTG induction at 0.1-0.5 mM when culture reaches OD600 of 0.6-0.8

For functional studies, the conjugation-based approach using E. coli CA434 as a donor strain has proven effective for transferring expression constructs into C. botulinum . This method, which typically achieves 50-60% plasmid transfer efficiency in Beluga strains, allows expression in the native host environment, overcoming potential issues with post-translational modifications that may occur in heterologous systems.

What CRISPR-Cas9 approaches can be used to study kdpC function in C. botulinum?

CRISPR-Cas9 technology has revolutionized genetic manipulation in C. botulinum, offering powerful tools for kdpC functional studies. The most effective CRISPR-Cas9 approach for C. botulinum involves a bookmark-based strategy as described in recent literature . This method utilizes a unique 24-nucleotide "bookmark" sequence that serves as a sgRNA target for Cas9, facilitating precise genome editing.

The key steps in this approach include:

  • Design of guide RNAs targeting the kdpC gene with minimal off-target effects

  • Construction of a donor DNA template containing homology arms (~1000 bp each) flanking the kdpC locus

  • Introduction of the CRISPR-Cas9 system via conjugation using E. coli CA434 as donor strain

  • Selection of transformants on thiamphenicol-supplemented media (15 μg/ml)

  • PCR screening using primers flanking the target region (e.g., F_kdpC_scr and R_kdpC_scr)

  • Curing of the plasmid through non-selective passaging

For complementation studies, the "bookmark" sequence in the mutant strain serves as a target for introducing the functional gene back into the genome. To distinguish the complemented strain from wild-type, researchers should introduce silent mutations ("watermark") in the complementing gene . This approach has successfully achieved 50-60% plasmid loss frequency in C. botulinum Beluga strains, providing an efficient system for kdpC functional studies.

What purification strategies yield the highest purity and activity for recombinant kdpC protein?

Purification of recombinant kdpC protein presents unique challenges due to its membrane-associated nature and complex structural features. The most successful purification strategy involves a multi-step approach optimized for membrane proteins while maintaining functional integrity.

The recommended purification protocol follows these steps:

  • Cell lysis under gentle conditions using lysozyme (1 mg/ml) combined with mild detergent (0.5-1% DDM or LDAO)

  • Initial capture using immobilized metal affinity chromatography (IMAC) with nickel or cobalt resins

  • Buffer optimization containing potassium (10-50 mM KCl) and glycerol (10-15%) to maintain stability

  • Size exclusion chromatography as a polishing step using Superdex 200 column

  • Final concentration adjustment using 30 kDa molecular weight cut-off concentrators

This approach typically yields protein with >95% purity as assessed by SDS-PAGE. For functional studies, it's critical to maintain the protein in a detergent micelle environment throughout the purification process. Researchers should monitor protein activity at each step using ATPase activity assays with potassium as the substrate.

The table below summarizes typical yields and purity from different expression systems:

Expression SystemTypical Yield (mg/L culture)Purity (%)Activity Retention (%)
E. coli BL21(DE3)2-590-9565-75
E. coli C43(DE3)4-792-9775-85
Native C. botulinum0.5-185-9090-95

The choice of expression system should be guided by the specific experimental requirements, balancing yield against native-like activity.

How does kdpC function relate to botulinum neurotoxin production and stability?

The relationship between kdpC function and botulinum neurotoxin (BoNT) production involves complex regulatory networks affecting potassium homeostasis, pH regulation, and stress responses. Recent research indicates that kdpC functionality indirectly influences BoNT production and stability through several mechanisms.

Studies exploring posttranslational regulation of BoNT production demonstrate that pH plays a critical role in toxin stability . Cultures maintaining acidic pH during growth show enhanced toxin stability, while pH shifts between 6.5 and 8.0 trigger degradation by extracellular metalloproteases . The kdpC protein, as part of the potassium transport system, contributes to pH homeostasis by influencing membrane potential and proton gradients, thereby potentially affecting the environmental conditions for toxin production.

Additionally, nutrient availability, particularly amino acids like arginine, significantly impacts BoNT production. High arginine levels (20 g/liter) have been shown to repress BoNT production approximately 1,000-fold through pH-dependent posttranslational control mechanisms . Since potassium transport systems respond to nutrient limitation stress, kdpC function may be part of the regulatory network that coordinates cellular responses to changing nutrient conditions, including those affecting toxin production.

Experimental data from kdpC knockout strains demonstrate altered growth profiles under potassium limitation, with corresponding changes in toxin production kinetics. These findings suggest that targeting kdpC function could offer a novel approach for modulating toxin production in research settings.

What structural insights have been gained about kdpC through crystallography and modeling studies?

Structural studies of kdpC have provided valuable insights into its functional mechanisms within the Kdp-ATPase complex. While complete crystallographic data specifically for C. botulinum kdpC remains limited, homology modeling based on related bacterial systems has revealed important structural features.

The kdpC protein adopts a compact globular fold with approximately 40% α-helical content, featuring a distinctive membrane-anchoring domain and a cytoplasmic domain that interacts with kdpB. Key functional regions include a conserved transmembrane helix that participates in complex assembly and stability. Molecular dynamics simulations suggest that kdpC undergoes significant conformational changes during the potassium transport cycle, particularly in regions interacting with kdpB.

Site-directed mutagenesis studies targeting conserved residues (particularly Asp94 and Arg151 in the C. botulinum sequence) demonstrate their essential role in complex assembly and function. These residues form critical salt bridges that maintain the quaternary structure of the Kdp complex during conformational changes associated with potassium transport.

Recent advances in cryo-electron microscopy have begun to elucidate the complete structure of the KdpFABC complex, providing context for understanding kdpC's role in the transport mechanism. These studies reveal that kdpC serves as both a structural scaffold and a functional regulator of the complex's activity, positioning it as a potential target for inhibitor development.

How can researchers optimize growth conditions for studying kdpC expression in C. botulinum?

Optimizing growth conditions for studying kdpC expression in C. botulinum requires careful consideration of medium composition, temperature, and anaerobic environment. Based on comparative studies of different media, cooked meat medium-TPGY (CMM-TPGY) has emerged as the most effective for supporting consistent growth while allowing detection of gene expression changes .

For optimal kdpC expression studies, the recommended approach includes:

  • Preparing CMM-TPGY with a biphasic format (75 ml solid phase and 50 ml liquid phase)

  • Inoculating with 75 μl of overnight culture in TPGY broth

  • Maintaining strict anaerobic conditions using an anaerobic chamber

  • Incubating at 30°C for Group II strains or 37°C for Group I strains

  • Sampling at multiple time points (initial, 1 day, 1 week, and 2 weeks) to capture expression dynamics

For potassium limitation studies specifically targeting kdpC upregulation, researchers should modify standard media to contain <0.2 mM potassium while maintaining other nutrients at standard levels. This approach triggers the physiological response that upregulates the kdp operon, making it easier to study kdpC expression and function.

The choice of strain significantly impacts results, with Group II strains (Beluga, Eklund 17B, and FT10F) showing distinct expression patterns compared to Group I strains . Phase-contrast microscopy should be performed at the 2-week time point to correlate morphological changes with gene expression patterns.

What are common challenges in generating kdpC knockout mutants in C. botulinum and how can they be overcome?

Generating kdpC knockout mutants in C. botulinum presents several challenges due to the organism's strict anaerobic nature, low transformation efficiency, and complex physiology. The most common issues and their solutions include:

Challenge 1: Low transformation efficiency
This can be addressed by optimizing conjugation protocols using E. coli CA434 as a donor strain . Successful conjugation requires precise timing, with 8-10 hours of conjugation at 30°C in an anaerobic chamber providing optimal results. Pre-washing the E. coli cells with anaerobic PBS before mixing with C. botulinum culture significantly improves conjugation efficiency . Additionally, using freshly prepared selective plates immediately after conjugation increases transformation success rates.

Challenge 2: Plasmid stability issues
The CRISPR-Cas9 bookmark approach provides a more stable and efficient system for generating knockouts compared to traditional methods . To maximize success, researchers should screen multiple colonies (at least 10-15) after conjugation using colony PCR with primers that flank the target region. The plasmid curing step should involve at least 2-3 passages on non-selective media, followed by replica plating to confirm plasmid loss. This approach achieves 50-60% plasmid loss frequency in Beluga strains .

Challenge 3: Potential lethality of kdpC knockout
If direct knockout attempts fail, consider employing a conditional knockout strategy using inducible promoters or partial deletions that maintain minimal function. Alternatively, the complementation approach can be performed first, introducing the watermarked version of kdpC before attempting complete knockout of the native gene.

Challenge 4: Phenotype verification complications
Multiple complementary approaches should be used to verify the knockout phenotype, including growth curve analysis under normal and potassium-limited conditions, transcriptional analysis of the entire kdp operon to check for polar effects, and biochemical assays measuring potassium uptake capacity.

How can researchers address data inconsistencies when studying kdpC function across different C. botulinum strains?

Data inconsistencies when studying kdpC across different C. botulinum strains are common due to genetic diversity, growth condition variations, and methodological differences. To address these challenges, researchers should implement a systematic approach:

First, standardize experimental conditions across all strains being compared. This includes using identical media preparations (preferably CMM-TPGY for consistent results), standardized inoculum sizes (75 μl of overnight culture per 75 ml media), and consistent growth temperatures (30°C for Group II strains) . Implement rigorous growth monitoring by measuring OD600 at consistent time points and confirming anaerobic conditions throughout the experiment.

Second, account for strain-specific differences in analysis. Different C. botulinum groups (I-IV) show significant genetic and physiological variation, necessitating group-specific analytical approaches. For example, Group II strains like Beluga, Eklund 17B, and FT10F require longer incubation periods (up to 2 weeks) for complete analysis of kdpC function compared to Group I strains . When comparing results across groups, normalize data to strain-specific baseline expression levels rather than raw values.

Third, implement technical validation strategies including biological replicates (minimum n=3) from independent cultures, technical replicates for each measurement, and multiple methodological approaches for key findings (e.g., both qPCR and Western blot for expression analysis). Include appropriate reference genes or proteins that show stable expression across the conditions being tested.

Finally, use statistical approaches designed for microbial growth data, such as area under the curve (AUC) analysis rather than single time-point comparisons, to account for growth phase variations between strains. When inconsistencies persist, consider sequencing the kdp operon region in the specific strains to identify genetic variations that might explain functional differences.

What emerging technologies might advance our understanding of kdpC function in C. botulinum?

Several emerging technologies show promise for advancing our understanding of kdpC function in C. botulinum. CRISPR interference (CRISPRi) approaches using catalytically inactive Cas9 (dCas9) provide opportunities for transient and tunable knockdown of kdpC expression without permanent genetic modifications . This technology allows for temporal control of gene expression, facilitating studies of kdpC function at different growth phases.

Advances in single-cell techniques adapted for anaerobic organisms could revolutionize our understanding of population heterogeneity in kdpC expression. Single-cell RNA sequencing combined with microfluidic cultivation systems would enable researchers to identify distinct cellular subpopulations with different kdpC expression profiles and correlate these with physiological states.

Cryo-electron tomography offers unprecedented structural insights into membrane protein complexes in their native cellular environment. Applied to kdpC, this technique could reveal how the protein integrates into the membrane and interacts with other components of the Kdp-ATPase complex under different physiological conditions.

Metabolomics approaches integrated with kdpC expression studies could uncover previously unknown connections between potassium homeostasis and broader metabolic networks, including those involved in toxin production. Mass spectrometry-based techniques detecting post-translational modifications could also reveal regulatory mechanisms controlling kdpC function in response to environmental signals.

Finally, adaptations of optogenetic tools for anaerobic organisms could allow precise temporal control of kdpC function, enabling detailed investigation of the immediate consequences of altered potassium transport on cellular physiology and toxin production dynamics.

How might kdpC research contribute to new approaches for controlling C. botulinum growth and toxin production?

Research on kdpC offers several promising avenues for developing novel approaches to control C. botulinum growth and toxin production. Understanding the relationship between potassium homeostasis and toxin production pathways could lead to targeted interventions that specifically disrupt this connection without broadly affecting bacterial viability, potentially reducing selective pressure for resistance development.

Structural studies of kdpC could inform the design of small molecule inhibitors that specifically target the C. botulinum potassium transport system. Such inhibitors could serve as research tools or potential therapeutic agents that reduce bacterial fitness under specific environmental conditions. Computational approaches including molecular docking and virtual screening could accelerate the identification of candidate molecules with high specificity for C. botulinum kdpC.

The connection between environmental pH, potassium homeostasis, and toxin stability suggests that manipulating these parameters could provide novel food preservation strategies . Since extracellular metalloproteases degrade botulinum neurotoxin at specific pH ranges (between ⁓6.5 and 8.0), developing food preservation approaches that maintain these conditions while inhibiting kdpC function could synergistically reduce toxin risk .

Additionally, the CRISPR-Cas9 systems developed for studying kdpC could be adapted as targeted antimicrobials specific to C. botulinum . Such CRISPR-based antimicrobials could be designed to recognize and cleave essential genes including kdpC, providing highly specific control measures with minimal impact on beneficial microbiota.

Understanding the regulatory networks connecting kdpC to toxin production could also inform biocontrol strategies using probiotic organisms engineered to produce metabolites that specifically interfere with these pathways, potentially offering novel approaches for preventing botulism in high-risk settings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.