Recombinant Clostridium botulinum Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Role

Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol (PG) to the conserved cysteine residue in the "lipobox" motif (consensus: [LVI][ASTVI][GAS]C) of prolipoproteins . This modification:

  • Anchors lipoproteins to bacterial membranes.

  • Is critical for outer membrane integrity in Gram-negative bacteria .

  • Serves as a prerequisite for subsequent processing steps mediated by signal peptidase II (Lsp) and apolipoprotein N-acyltransferase (Lnt) .

In C. botulinum, Lgt’s activity likely supports virulence by enabling proper localization of lipoproteins involved in toxin secretion or host interaction.

  • Central cavity: A 20-Å-deep hydrophobic pocket with periplasmic-facing polar residues (e.g., R143, R239) critical for PG binding .

  • PG-binding sites: Two distinct sites facilitate substrate recognition and catalysis. Site 1 selects PG via electrostatic interactions, while Site 2 positions the lipid for transfer .

  • Catalytic residues: Mutagenesis identifies R143, R239, E151, and Y26 as essential for diacylglyceryl transfer .

Mechanism of Action

The catalytic cycle involves:

  1. PG recognition: PG’s headgroup interacts with positively charged residues (e.g., R143) in the periplasmic cavity .

  2. Lipid transfer: The diacylglyceryl moiety is transferred to the cysteine thiol of the prolipoprotein, releasing glycerolphosphate .

  3. Product release: The lipid-modified lipoprotein exits laterally into the membrane via clefts in the Lgt structure .

Key kinetic features:

  • Diethylpyrocarbonate inactivation (rate: 18.6 M⁻¹s⁻¹) implicates histidine or tyrosine in catalysis .

  • Reversible inhibition by palmitic acid suggests competitive binding at the active site .

4.1. Heterologous Production

While no direct data exists for C. botulinum Lgt, recombinant Lgt homologs like E. coli Lgt have been:

  • Overexpressed in E. coli membrane fractions .

  • Purified using detergent solubilization and affinity chromatography .

4.2. Functional Insights from Mutagenesis

Mutation (E. coli Lgt)Effect on ActivityFunctional Role
G104S (SK634 mutant)Temperature-sensitive lossDisrupts conserved GGLIG motif
R143AAbolished activityPG binding and catalysis
R239A90% activity lossStabilizes transition state
Y26ALethalStructural integrity

Data from .

5.1. Antibiotic Target Validation

  • Lgt depletion in E. coli causes outer membrane defects and sensitizes bacteria to serum killing .

  • Inhibitors like macrocycles G2823/G2824 block Lgt activity in vitro (IC₅₀: ~1 μM) and exhibit bactericidal effects .

5.2. Vaccine Development

Though not directly linked to Lgt, recombinant C. botulinum proteins (e.g., BoNT/A HC domain) have been engineered for dual-serotype vaccines . Similar strategies could apply to Lgt for antitoxin or antibacterial vaccines.

Research Gaps and Future Directions

  • Structural data: No crystal structures exist for C. botulinum Lgt; homology modeling based on E. coli Lgt (PDB: 5JNI) is needed.

  • Functional assays: Activity measurements using C. botulinum-specific lipobox peptides would clarify substrate specificity.

  • Inhibitor optimization: Structure-guided design could enhance potency of Lgt-targeted antibiotics .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; CBO3209; CLC_3119; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
Target Names
lgt
Target Protein Sequence
MNPIAFHVGNLAIRWYGVIISMGTALGLLLAMYNCKIREASYDEFINMFLIAFPSAIIGA RLYYVIFEFEDYRDNLINIFNTRQGGLAIHGGIIFGVLAVYIYLKYRKESFFEYVDVAAP SIILGQAIGRWGNFFNSEAHGGPVTKEFISKFPQFIQNGMFIEGTYYHPTFLYESIWNFI ICIFLVYLLKKTKKKGIVFMAYIGLYSLGRFFIEGLRTDSLYLGSIRVAQLISVLGIILS IFFIYNIIKKEKRY
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the first step in the formation of mature lipoproteins.
Database Links

KEGG: cbh:CLC_3119

Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of prolipoprotein diacylglyceryl transferase in Clostridium botulinum?

Prolipoprotein diacylglyceryl transferase (Lgt) in C. botulinum, similar to its counterpart in E. coli, is an integral membrane enzyme that catalyzes the first reaction of the three-step post-translational lipid modification pathway for bacterial lipoproteins . It transfers a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox of prolipoproteins. This modification is crucial for bacterial survival as lipoproteins fulfill wide-ranging and vital biological functions, including maintenance of cell envelope architecture, insertion and stabilization of outer membrane proteins, nutrient uptake, transport, adhesion, invasion, and virulence . The lgt gene is particularly essential as its deletion is lethal to most Gram-negative bacteria, highlighting its potential as a therapeutic target .

What role does lgt play in botulinum neurotoxin production and virulence?

While the search results don't directly address this relationship, we can infer that as a key enzyme in lipoprotein biogenesis, lgt likely contributes to C. botulinum virulence through several mechanisms. Botulinum neurotoxins (BoNTs) produced by C. botulinum are potent protein toxins that cause botulism, leading to death or neuroparalysis by targeting the nervous system . BoNTs comprise three functional domains: a light-chain enzymatic domain (LC), a heavy-chain translocation domain (HC N), and a heavy-chain receptor-binding domain (HC C) . The proper assembly, secretion, and delivery of these toxins likely depend on correctly processed lipoproteins, which would involve lgt-mediated modifications. The lgt pathway may also affect bacterial membrane integrity and surface protein display, indirectly influencing toxin production or secretion systems. These connections warrant further investigation in C. botulinum-specific studies.

What expression systems are most effective for recombinant C. botulinum lgt production?

Based on successful approaches with similar bacterial proteins, Escherichia coli expression systems are most commonly used for recombinant production of C. botulinum proteins. For membrane proteins like lgt, E. coli BL21(DE3) and E. coli Rosetta™ 2(DE3) strains have demonstrated efficiency in producing functionally active recombinant proteins . The Rosetta strain is particularly advantageous as it supplies tRNAs for rare codons that may be present in C. botulinum genes . Expression vectors such as pET-45b and pET-22b (Novagen) with N-terminal or C-terminal His-tags facilitate purification . When working with lgt specifically, researchers should consider membrane-targeted expression systems due to its integral membrane nature. Induction conditions typically involve IPTG at concentrations between 0.1-1 mM, with expression at lower temperatures (16-25°C) to enhance proper folding of membrane proteins . Alternative expression systems such as cell-free systems might be considered for challenging membrane proteins that form inclusion bodies in conventional systems.

What purification strategies yield highest purity and activity for recombinant C. botulinum lgt?

Purification of recombinant C. botulinum lgt likely requires specialized approaches similar to those used for E. coli lgt and other membrane proteins. A recommended protocol would include:

  • Cell lysis using mechanical disruption (sonication or French press) in buffer containing appropriate detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS) to solubilize membrane proteins

  • Initial purification via Ni-NTA affinity chromatography, utilizing His-tags incorporated during expression

  • Further purification through size exclusion chromatography to remove aggregates

  • Optional ion exchange chromatography for removing co-purified contaminants

For optimal activity retention, purification buffers should maintain pH 7.5-8.0 and contain stabilizing agents such as glycerol (10-20%) and reducing agents like DTT or β-mercaptoethanol . Protein purity can be assessed via SDS-PAGE, and functionality can be verified through enzymatic activity assays measuring transfer of diacylglyceryl moieties from phosphatidylglycerol to appropriate substrate peptides . Western blot analysis using antibodies against the His-tag or specific anti-lgt antibodies can confirm identity and integrity of the purified protein.

How can functional activity of purified recombinant C. botulinum lgt be verified and quantified?

Functional verification of recombinant C. botulinum lgt requires assays that directly measure its enzymatic activity. Based on methodologies used for E. coli lgt, researchers can implement:

  • In vitro diacylglyceryl transfer assay: This measures the transfer of the diacylglyceryl moiety from phosphatidylglycerol to a synthetic peptide substrate containing the lipobox consensus sequence. The reaction products can be analyzed by thin-layer chromatography or HPLC with detection of radiolabeled or fluorescently labeled lipids .

  • GFP-based in vitro assay: Similar to approaches used for E. coli Lgt, a GFP-based assay can correlate lgt activities with structural observations . This typically involves fusion proteins containing GFP and lipobox sequences as substrates.

  • Complementation assays in lgt-knockout bacterial strains: Functional activity can be assessed by the ability of recombinant C. botulinum lgt to complement growth defects in lgt-deficient bacterial strains .

Quantification of enzymatic activity should include determination of kinetic parameters (Km, Vmax) using varying concentrations of substrate and enzyme. Researchers should also investigate the effects of temperature, pH, and potential inhibitors on enzyme activity to establish optimal conditions for functional studies.

How does lgt structure-function relationship impact botulinum toxin production pathways?

Understanding the structure-function relationship of lgt provides critical insights into botulinum toxin production pathways. The crystal structures of E. coli Lgt show that the enzyme contains two binding sites and has critical residues, including Arg143 and Arg239, that are essential for diacylglyceryl transfer . These structural features likely enable lgt to modify lipoproteins involved in cell envelope maintenance and protein secretion pathways. In C. botulinum, proper functioning of lgt is presumably critical for maintaining membrane integrity and the secretion machinery required for botulinum neurotoxin export.

The three-domain structure of botulinum neurotoxins (BoNTs) - comprising the light-chain enzymatic domain (LC), heavy-chain translocation domain (HC N), and heavy-chain receptor-binding domain (HC C) - requires sophisticated cellular machinery for proper assembly and secretion . Lipoproteins modified by lgt likely participate in these processes, potentially through:

  • Stabilization of secretion complexes in the bacterial membrane

  • Facilitating proper folding of toxin components

  • Contributing to specialized secretion systems for toxin export

Mutations in critical residues of lgt could therefore impact toxin production and virulence, making this a valuable avenue for research into pathogenicity mechanisms and potential therapeutic targets. Future studies coupling site-directed mutagenesis of lgt with toxin production assays would provide valuable insights into these relationships.

What novel approaches can be used to study C. botulinum lgt inhibition as a therapeutic strategy?

Targeting lgt inhibition presents a promising therapeutic strategy against C. botulinum, given that deletion of the lgt gene is lethal to most Gram-negative bacteria . Novel research approaches include:

  • Structure-based drug design: Using the crystal structures of bacterial lgt (such as E. coli Lgt) as templates for homology modeling of C. botulinum lgt, researchers can identify potential binding pockets for inhibitor design . Virtual screening and molecular dynamics simulations can identify lead compounds that disrupt lgt activity.

  • High-throughput screening platforms: Development of fluorescence-based or FRET-based assays to monitor lgt activity in real-time would facilitate screening of chemical libraries for potential inhibitors.

  • Lipid analog development: Design of substrate analogs that compete with phosphatidylglycerol binding but cannot be processed by lgt could serve as competitive inhibitors.

  • CRISPR-Cas9 knockdown systems: For studying the effects of partial lgt inhibition on bacterial viability and toxin production, employing tunable CRISPR interference approaches rather than complete gene deletion.

  • Liposome-based assay systems: Reconstitution of purified lgt in liposomes containing fluorescently labeled phosphatidylglycerol and synthetic peptide substrates would enable detailed mechanistic studies and inhibitor screening in a membrane environment that closely mimics natural conditions.

The development of specific lgt inhibitors would need to address selectivity for bacterial over human enzymes and penetration of the bacterial cell envelope. Combined approaches using structural biology, biochemistry, and medicinal chemistry offer the most promising path forward.

How does C. botulinum lgt interact with the receptor binding domain (HC) of botulinum neurotoxins?

While direct interactions between C. botulinum lgt and the receptor binding domain (HC) of botulinum neurotoxins have not been extensively documented in the search results, potential interactions can be hypothesized based on their respective functions.

The HC domain of BoNTs is critical for binding to neuronal cell membrane receptors and facilitating toxin internalization via endocytosis . Recent research has focused on producing recombinant HC domains of all eight BoNT/A subtypes (A1-A8) in E. coli for vaccine development and antitoxin screening . These domains have been successfully expressed and purified, and their antigenicity confirmed through ELISA using commercial polyclonal antibodies .

Lgt, as an enzyme involved in lipoprotein biogenesis, may influence the cellular environment in which BoNTs are produced. Potential interactions could include:

  • Indirect effects through lipoproteins involved in toxin secretion or assembly

  • Modification of membrane properties affecting toxin binding or insertion

  • Potential involvement in post-translational modifications of toxin components

Research approaches to investigate these interactions could include co-immunoprecipitation studies, proximity labeling techniques (BioID or APEX), or fluorescence resonance energy transfer (FRET) experiments with tagged proteins. Comparative studies of toxin production and secretion in wild-type versus lgt-depleted (using conditional knockdown approaches) C. botulinum strains would also provide valuable insights into functional relationships between these components.

What are the critical parameters for successful site-directed mutagenesis of C. botulinum lgt?

Successful site-directed mutagenesis of C. botulinum lgt requires careful consideration of several critical parameters:

  • Primer design:

    • Primers should contain the desired mutation centrally positioned

    • Ensure GC content of 40-60% and melting temperature (Tm) of 75-85°C

    • Incorporate 15-25 base pairs of complementary sequence on each side of the mutation

    • Verify absence of secondary structures using software tools

  • Template quality:

    • Use highly purified plasmid DNA (A260/A280 ratio > 1.8)

    • Ensure template is methylated (dam+) if using DpnI digestion to remove parental DNA

  • PCR optimization:

    • Adjust polymerase selection (high-fidelity enzymes like Phusion or Q5)

    • Optimize annealing temperatures (typically 5°C below the lowest primer Tm)

    • Use longer extension times for GC-rich regions

  • Verification strategies:

    • Screen transformants by restriction enzyme analysis when possible

    • Confirm mutations by Sanger sequencing of the entire lgt gene

For the specific case of C. botulinum lgt, researchers should pay special attention to GC-rich regions and consider codon optimization for expression in heterologous systems. The methodology demonstrated in search result for producing expression vectors for BoNT/A2-A8 from pET45b-HCA1 by site-directed mutagenesis provides a good model . Their success in generating multiple variants suggests that similar approaches could be effective for C. botulinum lgt. Verification of mutagenesis success should include both sequencing confirmation and functional assays to assess the impact of mutations on enzymatic activity.

How can researchers overcome solubility challenges when expressing recombinant C. botulinum lgt?

Membrane proteins like lgt frequently present solubility challenges during recombinant expression. Based on successful approaches with similar proteins, researchers can employ several strategies:

  • Expression condition optimization:

    • Lower induction temperatures (16-20°C)

    • Reduced IPTG concentrations (0.1-0.5 mM)

    • Extended induction times (overnight to 48 hours)

    • Addition of compatible solutes (glycerol, sorbitol) to culture media

  • Fusion tag approaches:

    • N-terminal solubility-enhancing tags (MBP, SUMO, TrxA)

    • C-terminal stabilization tags (GFP to monitor folding)

    • Inclusion of TEV or PreScission protease sites for tag removal

  • Host strain selection:

    • C41(DE3) or C43(DE3) strains engineered for membrane protein expression

    • Rosetta strains for rare codon supplementation

  • Detergent screening:

    • Systematic evaluation of detergents for membrane protein extraction (n-dodecyl-β-D-maltoside, CHAPS, Triton X-100)

    • Use of detergent mixtures or lipid-detergent mixed micelles

  • Directed evolution approaches:

    • Random mutagenesis libraries to identify more soluble variants

    • Targeted mutations at membrane-interface residues

A particularly effective approach combines reduced temperature expression (18°C) with the use of E. coli Rosetta 2(DE3), as demonstrated for the successful expression of recombinant HC domains of BoNT/A subtypes . For purification, Ni-NTA spin columns followed by size exclusion chromatography in detergent-containing buffers have proven successful for membrane proteins . Protein quality should be assessed using SDS-PAGE, Western blotting, and activity assays to confirm proper folding and function.

What analytical techniques are most effective for characterizing lgt-substrate interactions?

Characterizing interactions between C. botulinum lgt and its substrates requires sophisticated analytical techniques that can provide insights into binding kinetics, structural arrangements, and catalytic mechanisms. Based on approaches used for similar enzymes, the following methods are recommended:

  • Isothermal Titration Calorimetry (ITC):

    • Provides direct measurement of binding thermodynamics (ΔH, ΔS, ΔG)

    • Determines binding stoichiometry and affinity constants

    • Requires purified lgt in detergent micelles and purified substrate

  • Surface Plasmon Resonance (SPR):

    • Enables real-time measurement of binding kinetics (kon and koff)

    • Can be used with immobilized lgt or substrate

    • Provides information about association/dissociation rates

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps protein regions involved in substrate binding

    • Identifies conformational changes upon substrate binding

    • Requires no protein labeling or modification

  • Cross-linking coupled with mass spectrometry:

    • Identifies specific amino acid residues at interaction interfaces

    • Captures transient interactions during catalysis

    • Can be performed in native-like membrane environments

  • Molecular dynamics simulations:

    • Models dynamic interactions between lgt and substrates

    • Predicts binding modes and energy landscapes

    • Can be validated with experimental results from techniques above

For membrane proteins like lgt, these techniques often require optimization to account for detergent effects. The crystallographic approaches that revealed E. coli Lgt in complex with phosphatidylglycerol and the inhibitor palmitic acid at 1.9 and 1.6 Å resolution provide valuable templates for such studies . Researchers should combine multiple techniques to build a comprehensive understanding of lgt-substrate interactions, as each method provides complementary information about different aspects of these complex biochemical processes.

How do recent structural insights into E. coli lgt inform potential C. botulinum lgt research directions?

The high-resolution crystal structures of E. coli Lgt in complex with phosphatidylglycerol and palmitic acid inhibitor (at 1.9 and 1.6 Å resolution, respectively) provide crucial insights that can guide C. botulinum lgt research . These structures revealed two binding sites and supported previously reported structure-function relationships of Lgt . Complementation results using lgt-knockout cells with different mutant Lgt variants identified critical residues, including Arg143 and Arg239, as essential for diacylglyceryl transfer .

For C. botulinum lgt research, these findings suggest several promising directions:

  • Homology modeling and structural prediction of C. botulinum lgt based on E. coli templates, followed by validation through directed mutagenesis of predicted catalytic residues

  • Investigation of the lateral entry and exit of substrates and products relative to the lipid bilayer, as supported by E. coli lgt structural studies

  • Exploration of species-specific differences in substrate recognition that might be exploited for selective inhibitor design

  • Analysis of membrane topology and integration patterns that might affect lgt function in the context of C. botulinum's distinct cell envelope architecture

  • Development of GFP-based in vitro assays similar to those used for E. coli lgt to correlate structure with activity

These research directions could lead to both fundamental advances in understanding bacterial lipoprotein biogenesis and applied outcomes in therapeutic development against botulism.

What role could C. botulinum lgt play in next-generation botulinum vaccine development?

While current botulinum vaccine development efforts focus primarily on the receptor binding domain (HC C) of botulinum neurotoxins , C. botulinum lgt represents an unexplored but potentially valuable target for alternative vaccine strategies. The rationale for investigating lgt in vaccine development includes:

  • Essential nature of lgt: As demonstrated in other bacteria, lgt is critical for viability, making it an attractive target for attenuated vaccine development . Strains with regulated or partially functional lgt might maintain immunogenicity while reducing virulence.

  • Conservation across serotypes: Unlike the variable receptor binding domains that differ among BoNT serotypes (A-G) and subtypes (A1-A8, etc.) , lgt likely maintains higher conservation, potentially providing broader protection against multiple toxin variants.

  • Dual-target approach: Combining recombinant HC domains (as in the fusion vaccine candidate rHC CB-L-HC CA) with lgt-targeted components could enhance vaccine efficacy through multiple immunological mechanisms.

  • Alternative delivery systems: Lipoproteins processed by lgt could serve as adjuvants or delivery vehicles for BoNT immunogenic epitopes, leveraging the body's natural recognition of bacterial lipoproteins via Toll-like receptors.

Research approaches could include development of attenuated C. botulinum strains with modified lgt, creation of recombinant fusion proteins incorporating lgt epitopes with BoNT HC domains, and evaluation of lipoprotein-based adjuvant systems for enhancing immune responses to conventional BoNT antigens. The successful development of a recombinant fusion vaccine candidate against both BoNT/A and B demonstrates the feasibility of multi-target approaches .

How do comparative genomic analyses of lgt across Clostridium species inform functional predictions?

Comparative genomic analyses of lgt across Clostridium species provide valuable insights into evolutionary conservation, functional adaptations, and potential species-specific mechanisms. While the search results don't directly address this comparison, a systematic approach would include:

  • Sequence conservation analysis:

    • Identification of highly conserved motifs across Clostridium species

    • Mapping of variable regions that might confer substrate specificity

    • Phylogenetic reconstruction to understand evolutionary relationships

  • Genomic context examination:

    • Analysis of gene neighborhoods surrounding lgt in different species

    • Identification of co-evolved gene clusters suggesting functional relationships

    • Detection of horizontal gene transfer events that might have shaped lgt evolution

  • Structural prediction comparison:

    • Homology modeling of lgt from different Clostridium species

    • Superimposition of predicted structures to identify conserved binding pockets

    • Analysis of surface electrostatics and hydrophobicity patterns

  • Experimental validation:

    • Cross-species complementation assays to test functional conservation

    • Chimeric protein construction to identify species-specific functional domains

    • Comparative biochemical characterization of recombinant lgt from multiple species

These analyses could reveal adaptations in lgt that support the diverse ecological niches occupied by different Clostridium species, from soil-dwelling saprophytes to human pathogens. Understanding these differences could inform targeted therapeutic approaches that exploit species-specific features while revealing fundamental aspects of bacterial lipoprotein biology. The methodology used for comparing receptor binding domains across BoNT/A subtypes could serve as a template for such comparative studies .

How can researchers differentiate between direct and indirect effects of lgt inhibition or mutation on botulinum toxin production?

Distinguishing direct from indirect effects of lgt inhibition or mutation on botulinum toxin production presents significant analytical challenges. Researchers should implement a multi-faceted approach:

  • Temporal analysis:

    • Establish time-course profiles of lgt activity, lipoprotein processing, and toxin production

    • Identify sequential events to establish cause-effect relationships

    • Use pulse-chase experiments to track the progression of specific cellular processes

  • Quantitative proteomics:

    • Apply stable isotope labeling (SILAC) or isobaric tagging (TMT/iTRAQ) to compare proteome changes

    • Develop selective enrichment methods for lipoproteins and toxin components

    • Implement targeted proteomics (MRM/PRM) for precise quantification of key pathway components

  • Genetic complementation strategies:

    • Create conditional lgt mutants with varying levels of expression

    • Perform rescue experiments with wild-type or mutant lgt variants

    • Implement orthogonal genetic systems to modulate lgt independently from native regulation

  • Cell biological approaches:

    • Use fluorescence microscopy with protein fusions to track subcellular localization

    • Implement super-resolution techniques to visualize membrane organization

    • Apply correlative light and electron microscopy to connect molecular events to ultrastructural changes

What statistical approaches are most appropriate for analyzing lgt enzymatic activity data?

Analysis of lgt enzymatic activity data requires robust statistical approaches tailored to biochemical kinetics and potentially complex datasets. Recommended statistical methods include:

  • Enzyme kinetics modeling:

    • Non-linear regression for Michaelis-Menten, allosteric, or more complex kinetic models

    • Global fitting of multiple datasets to constrain shared parameters

    • Bootstrap resampling to estimate confidence intervals for kinetic parameters

  • Comparative analysis:

    • ANOVA with appropriate post-hoc tests for comparing activity across multiple conditions

    • Mixed-effects models to account for batch variation in protein preparations

    • Equivalence testing when comparing mutants to wild-type enzyme

  • Inhibition studies:

    • Competitive, non-competitive, or mixed inhibition models selection based on AIC or BIC criteria

    • IC50 determination with robust error estimation

    • Hill equation fitting for cooperative binding phenomena

  • Quality control:

    • Outlier detection using robust statistical methods (e.g., ROUT method)

    • Normality testing and appropriate transformations when required

    • Power analysis for experimental design optimization

For visualization, researchers should consider:

  • Residual plots to assess goodness-of-fit

  • Confidence bands around fitted curves

  • Forest plots for comparing parameters across multiple experimental conditions

The GFP-based in vitro assay used for E. coli Lgt activity correlation with structural observations provides a template for data collection approaches . When working with membrane proteins like lgt, additional statistical considerations should address detergent effects, protein stability over time, and potential ligand depletion effects at membrane interfaces. Bayesian approaches might be particularly valuable for integrating prior knowledge from E. coli lgt studies when analyzing C. botulinum lgt data with limited sample sizes.

How can researchers resolve contradictions in experimental data when characterizing C. botulinum lgt structure and function?

Resolving contradictions in experimental data when characterizing C. botulinum lgt requires systematic investigation of potential sources of variability and careful integration of multiple experimental approaches. A structured approach includes:

  • Technical validation:

    • Assess reproducibility through independent replications

    • Implement blind analysis to minimize confirmation bias

    • Verify reagent quality and consistency (protein preparations, lipid substrates)

    • Calibrate instruments and standardize protocols across experiments

  • Biological validation:

    • Test multiple strains or isolates of C. botulinum

    • Consider growth conditions that might affect membrane composition

    • Examine potential post-translational modifications or alternative splicing

    • Account for potential genetic suppressor mutations

  • Methodological cross-validation:

    • Apply orthogonal techniques to measure the same parameter

    • Compare in vitro, in vivo, and in silico approaches

    • Validate key findings in related Clostridium species

  • Data integration strategies:

    • Implement Bayesian frameworks to update models as new data emerges

    • Use meta-analysis approaches for quantitative synthesis across studies

    • Develop computational models that can reconcile apparently contradictory observations

When faced with specific contradictions, researchers should:

  • First establish whether discrepancies arise from technical artifacts or reflect genuine biological complexity

  • Consider environmental factors that might affect lgt function (pH, temperature, membrane composition)

  • Examine potential allosteric regulators or interacting partners that might modulate activity

  • Investigate post-translational modifications that could create functional heterogeneity

The successful resolution of such contradictions often leads to deeper insights into protein function. For example, the discovery of two binding sites in E. coli Lgt through crystallographic studies likely resolved previous mechanistic uncertainties . Similarly, comparative approaches examining lgt across multiple bacterial species can help distinguish species-specific features from conserved mechanisms.

How can structural insights from C. botulinum lgt be leveraged for antimicrobial drug development?

Structural insights from C. botulinum lgt offer significant potential for antimicrobial drug development through several strategic approaches:

  • Structure-based inhibitor design:

    • Target the active site responsible for diacylglyceryl transfer

    • Design compounds that mimic the transition state of the enzymatic reaction

    • Develop allosteric inhibitors that stabilize inactive conformations

    • Create phosphatidylglycerol analogs that compete for binding but resist catalysis

  • Targeting critical protein-protein or protein-lipid interactions:

    • Disrupt interactions between lgt and other components of the lipoprotein processing machinery

    • Design peptides or small molecules that interfere with substrate recognition

    • Develop compounds that alter membrane microdomains where lgt functions

  • Species-selective inhibition:

    • Exploit structural differences between C. botulinum lgt and human enzymes

    • Target unique binding pockets identified through comparative structural analysis

    • Design prodrugs activated by C. botulinum-specific enzymes for selectivity

The crystal structures of E. coli Lgt in complex with phosphatidylglycerol and palmitic acid inhibitor provide valuable templates for these approaches . Complementation studies identifying critical residues like Arg143 and Arg239 point to potential hotspots for inhibitor binding . Since lgt deletion is lethal to most Gram-negative bacteria , inhibitors would likely have broad-spectrum activity with potential applications beyond C. botulinum.

Development pathways should include iterative cycles of structure-based design, biochemical validation, and assessment of bacterial penetration and resistance potential. Combination strategies with existing botulinum antitoxins could provide synergistic therapeutic approaches for both preventing and treating botulism.

What experimental systems best model the integration of C. botulinum lgt into vaccine development pipelines?

Integrating C. botulinum lgt into vaccine development pipelines requires specialized experimental systems that can effectively model antigenic presentation, immune response generation, and protection against challenge. Based on successful approaches with botulinum neurotoxin components, recommended experimental systems include:

  • In vitro antigen presentation systems:

    • Dendritic cell activation assays with recombinant lgt or lgt-modified lipoproteins

    • T-cell proliferation studies to assess immunogenicity

    • Toll-like receptor activation screens to evaluate adjuvant properties of lgt-modified proteins

  • Animal models for immunogenicity assessment:

    • Mouse immunization protocols similar to those used for evaluating rHC CB-L-HC CA vaccine candidate

    • Multiple immunization schedules (e.g., three doses at 2-week intervals) with alum adjuvant

    • Comparative studies of different routes of administration (intramuscular, subcutaneous, intranasal)

  • Challenge models for protection evaluation:

    • Lethal challenge testing with varying doses of botulinum toxin (expressed as LD50)

    • Functional recovery assessment in sub-lethal challenge models

    • Long-term protection studies to evaluate durability of immune response

  • Correlates of protection assays:

    • ELISA protocols to measure antibody titers against lgt and toxin components

    • Functional neutralization assays using cell-based systems

    • Epitope mapping to identify critical antigenic determinants

The experimental approach used for evaluating the fusion vaccine candidate rHC CB-L-HC CA provides a valuable template . This included intramuscular immunization of mice with the candidate plus alum three times at 2-week intervals, followed by assessment of antibody titers and protection against lethal challenges with BoNT/A and B .

For translational relevance, experimental systems should progressively advance from in vitro studies to small animal models and eventually to non-human primates before clinical evaluation. Integration of lgt components with established HC domain-based vaccine approaches could leverage existing development pipelines while potentially enhancing breadth of protection.

How can high-throughput screening approaches be optimized for identifying C. botulinum lgt inhibitors?

Optimizing high-throughput screening (HTS) approaches for C. botulinum lgt inhibitors requires careful consideration of assay design, compound libraries, and validation strategies. A comprehensive approach would include:

  • Primary assay development:

    • Enzymatic activity assays measuring transfer of diacylglyceryl groups

    • Fluorescence-based readouts for increased sensitivity and throughput

    • FRET or TR-FRET systems to monitor substrate-product conversion

    • Adaptation to 384- or 1536-well format for true high-throughput capacity

  • Compound library selection:

    • Focused libraries targeting phospholipid-binding proteins

    • Natural product collections that historically yield membrane-active compounds

    • Fragment-based approaches for identifying building blocks for more complex inhibitors

    • Diversity-oriented synthesis libraries to explore novel chemical space

  • Counter-screening and validation:

    • Orthogonal secondary assays to confirm hits (e.g., biophysical binding assays)

    • Selectivity panels against related enzymes from human and bacterial sources

    • Cytotoxicity assessment in mammalian cell lines

    • Whole-cell activity evaluation in C. botulinum or surrogate organisms

  • Hit-to-lead optimization workflows:

    • Structure-activity relationship studies guided by available structural information

    • Lipophilicity and permeability optimization for bacterial membrane penetration

    • Medicinal chemistry campaigns to improve potency while maintaining specificity

    • Integration of computational methods to predict metabolic stability and off-target effects

The successful expression and purification methods used for recombinant HC domains of BoNT/A subtypes could be adapted for producing sufficient quantities of C. botulinum lgt for HTS campaigns . Screening conditions should account for the membrane protein nature of lgt, potentially incorporating appropriate detergents or lipid environments to maintain native structure and function.

Data analysis approaches should include robust statistical methods for hit identification (e.g., Z-score, B-score), dose-response curve fitting for potency assessment, and machine learning algorithms to identify structural features associated with activity for subsequent library design.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.