Recombinant Clostridium botulinum UPF0059 membrane protein CBO0394 (CBO0394)

Shipped with Ice Packs
In Stock

Description

Introduction to CBO0394

Clostridium botulinum is a Gram-positive, spore-forming anaerobic bacterium notorious for producing botulinum neurotoxins (BoNTs), the most potent biological toxins known . While considerable research has focused on these neurotoxins, the bacterium's membrane proteins remain comparatively understudied despite their critical roles in cellular function. The UPF0059 membrane protein CBO0394 (UniProt ID: A5HYT8) represents one such protein that has gained attention as an important membrane component with potential roles in bacterial physiology .

CBO0394 belongs to the UPF0059 protein family and is cataloged as a putative manganese efflux pump (MntP1), suggesting its involvement in metal ion homeostasis within the bacterial cell . The protein appears to be conserved across different Clostridium botulinum strains, as evidenced by the existence of similar proteins like CLI_0469 in other C. botulinum variants . The conservation of this protein across strains points to its potential biological significance.

Recent advances in recombinant protein technology have enabled the production of full-length CBO0394 with His-tags, facilitating both structural and functional studies of this membrane protein. The ability to express and purify this protein has opened new avenues for investigating its properties and potential biotechnological applications .

Expression Systems and Vectors

The production of recombinant CBO0394 has been successfully achieved using E. coli as the expression host . This approach parallels methods used for other clostridial proteins, such as those described for recombinant holotoxoid vaccines, where E. coli expression systems have proven valuable for producing clostridial components .

The expression of CBO0394 involves the incorporation of a His-tag at the N-terminus, which facilitates purification through affinity chromatography . This expression strategy is similar to that employed for other membrane proteins, as documented in studies with Lactococcus lactis, where controlled expression and proper tagging are crucial for successful membrane protein production .

Purification and Quality Control

Following expression, the recombinant CBO0394 protein undergoes purification processes that result in a high-quality product with purity greater than 90% as determined by SDS-PAGE analysis . The purified protein is then typically processed into a lyophilized powder form for storage and distribution.

Quality control measures include verification of protein identity and purity through techniques such as SDS-PAGE and potentially Western blotting with anti-His antibodies, similar to the approaches used for other recombinant proteins . These quality control steps ensure the consistency and reliability of the recombinant protein for subsequent applications.

Table 1: Specifications of Recombinant CBO0394 Protein

ParameterSpecification
SpeciesClostridium botulinum
Expression HostE. coli
TagHis (N-terminal)
Protein LengthFull Length (1-183 aa)
FormLyophilized powder
Purity>90% (SDS-PAGE)
UniProt IDA5HYT8
SynonymsmntP1, Putative manganese efflux pump MntP 1

Putative Role as Manganese Efflux Pump

The functional characterization of CBO0394 remains an area where further research is needed. By analogy with other bacterial metal efflux systems, CBO0394 likely contributes to metal ion homeostasis, which is crucial for bacterial survival and pathogenicity. This function may be particularly important in the context of C. botulinum's lifecycle and its ability to produce neurotoxins.

Potential Role in Bacterial Physiology

As a membrane protein, CBO0394 may also contribute to membrane integrity and cellular functions beyond metal ion transport. Membrane proteins often serve multiple roles, including sensing environmental changes, facilitating nutrient uptake, and maintaining membrane potential. The specific contributions of CBO0394 to these aspects of C. botulinum physiology represent valuable areas for future investigation.

Understanding these functions could provide insights into bacterial adaptation mechanisms and potentially reveal new targets for antimicrobial interventions. The conservation of this protein across C. botulinum strains further underscores its likely importance in bacterial survival and function.

Functional Characterization

Recombinant CBO0394 can be used in functional assays to assess its metal transport capabilities and regulatory mechanisms. These studies might involve reconstituting the protein in liposomes or other membrane mimetics to evaluate its transport activity under controlled conditions . Additionally, site-directed mutagenesis could identify key residues involved in substrate binding and transport, analogous to approaches used for other membrane transporters.

Antibody Development and Diagnostic Applications

The purified recombinant protein serves as an excellent antigen for generating specific antibodies, which could be utilized in various immunological applications. These antibodies could facilitate the detection and localization of native CBO0394 in C. botulinum cells, contributing to our understanding of its expression patterns and subcellular distribution. Furthermore, such antibodies might have diagnostic applications in identifying C. botulinum in clinical or environmental samples.

Reconstitution Protocol

Proper handling of recombinant CBO0394 is essential for maintaining its integrity and functionality. The recommended reconstitution protocol involves centrifuging the vial briefly before opening to ensure all content is at the bottom . The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, the addition of glycerol (5-50% final concentration) is recommended, with 50% being the standard concentration used by manufacturers .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: Our proteins are typically shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your adjustments.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be decided during production. If you have a specific tag preference, please inform us, and we will prioritize its development.
Synonyms
mntP1; CBO0394; Putative manganese efflux pump MntP 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
Target Names
mntP1
Target Protein Sequence
MEVQELFLLALAISLDAFGVILCIGINKGITLKSSMIFVFSFGFFQFFLSFLGGYIGTIF NKYIVPIPTIVGGLIIIIVGILMITEGFKEKEESIFLNKIMYLILGVSVSIDALVIGFTT LSYINNLFYLFMSSLFMGLIATIICSLGIILSKYIKKISIISSYADYIGGIILILFGLKM LFF
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links

KEGG: cbo:CBO0394

Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Clostridium botulinum UPF0059 membrane protein CBO0394?

Recombinant Clostridium botulinum UPF0059 membrane protein CBO0394 (UniProt ID: A5HYT8) is a full-length (183 amino acid) bacterial membrane protein expressed in E. coli with an N-terminal His tag . The protein is also known as mntP1 or putative manganese efflux pump MntP 1, suggesting its potential role in metal ion transport across bacterial membranes . This recombinant protein is typically produced through heterologous expression systems to facilitate structural and functional studies of the native protein found in Clostridium botulinum.

How should researchers handle and store recombinant CBO0394?

For optimal stability and activity, recombinant CBO0394 should be stored as follows:

  • Store at -20°C or -80°C upon receipt

  • Aliquot the protein to avoid repeated freeze-thaw cycles

  • For working solutions, store aliquots at 4°C for up to one week

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage (recommended final concentration is 50%)

The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain protein stability during storage and reconstitution .

What is the putative function of CBO0394 in Clostridium botulinum?

Based on sequence homology and annotation as mntP1 (putative manganese efflux pump MntP 1), CBO0394 likely functions in manganese homeostasis within Clostridium botulinum . Manganese is an essential cofactor for many enzymes but becomes toxic at high concentrations. Membrane-bound efflux pumps like MntP typically function to export excess manganese from the bacterial cytoplasm to maintain appropriate intracellular concentrations.

The role of metal ion homeostasis in bacterial pathogenesis is increasingly recognized, particularly in the context of host-pathogen interactions where hosts may either sequester essential metals (nutritional immunity) or deliver toxic concentrations of metals to kill pathogens. Understanding CBO0394's function may provide insights into how C. botulinum adapts to varying metal concentrations in different environments.

How might CBO0394 relate to other membrane proteins involved in Clostridium botulinum toxicity?

While CBO0394 itself is not directly implicated in botulinum neurotoxin (BoNT) production or function, membrane proteins play crucial roles in bacterial survival and virulence. Clostridium botulinum produces potent neurotoxins that cause flaccid paralysis by inhibiting neurotransmitter (acetylcholine) release from presynaptic membranes .

The translocation domain (HN) of botulinum neurotoxins forms channels in endosomal membranes to facilitate toxin entry into the cytosol of neurons . Understanding the fundamental properties of C. botulinum membrane proteins like CBO0394 may provide broader insights into how this organism adapts to environmental conditions and interacts with host cells, potentially revealing new targets for therapeutic intervention.

What experimental approaches can be used to characterize CBO0394's metal transport activity?

To investigate the putative manganese transport function of CBO0394, researchers can employ several complementary approaches:

  • Metal sensitivity assays: Express CBO0394 in a manganese-sensitive bacterial strain and measure growth in media with varying manganese concentrations.

  • Direct transport assays: Use radioisotope-labeled manganese (54Mn) to measure metal uptake or efflux in proteoliposomes containing purified CBO0394.

  • Fluorescent metal indicators: Monitor manganese transport in real-time using fluorescent metal indicators in reconstituted systems.

  • Metal binding studies: Employ isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to characterize manganese binding to purified CBO0394.

  • Site-directed mutagenesis: Identify and mutate potential metal-coordinating residues to establish structure-function relationships.

These approaches would help establish whether CBO0394 indeed functions as a manganese efflux pump and characterize its transport kinetics and substrate specificity.

What expression systems are most effective for producing recombinant CBO0394?

The current standard for CBO0394 expression is an E. coli-based system with a His-tag fusion for purification . When designing an expression strategy for membrane proteins like CBO0394, consider the following:

Expression system optimization:

  • E. coli BL21(DE3) or C41/C43(DE3) strains are commonly used for membrane protein expression

  • Lower induction temperatures (16-25°C) often improve folding of membrane proteins

  • Consider testing multiple fusion tags beyond His-tag (MBP, SUMO, etc.) to enhance solubility

  • Specialized E. coli strains like Lemo21(DE3) allow tunable expression levels

Solubilization and purification strategy:

  • Screen multiple detergents for optimal solubilization (DDM, LMNG, DMNG)

  • Implement two-step purification (IMAC followed by size exclusion chromatography)

  • Consider adding lipids during purification to stabilize the membrane protein

The choice of expression system and purification strategy should be guided by the intended downstream applications, whether structural biology, functional assays, or antibody production.

What techniques are appropriate for studying CBO0394's membrane topology and insertion?

Understanding the membrane topology of CBO0394 is crucial for interpreting its function. Several complementary approaches can be employed:

Computational prediction:

  • Hydrophobicity analysis to identify potential transmembrane domains

  • Topology prediction algorithms (TMHMM, TOPCONS, MEMSAT)

Experimental validation:

  • Cysteine scanning mutagenesis: Introduce cysteine residues at various positions and probe their accessibility with membrane-impermeable thiol-reactive reagents

  • Protease protection assays: Determine which regions are protected from proteolysis by the membrane

  • Reporter fusion approaches: Fuse reporter proteins (GFP, PhoA) to different regions and assess their localization relative to the membrane

  • Fluorescence-based methods: Site-specific labeling with environment-sensitive fluorophores to monitor membrane proximity

  • Cryo-EM or X-ray crystallography: For high-resolution structural determination, though these are technically challenging for membrane proteins

A comprehensive topology model should integrate data from multiple approaches to overcome limitations of individual methods.

How can researchers effectively reconstitute CBO0394 into liposomes for functional studies?

Liposome reconstitution enables functional studies of membrane proteins in a controlled lipid environment. For CBO0394, consider this methodology:

Materials required:

  • Purified CBO0394 protein in detergent (e.g., DDM or LMNG)

  • Lipids (typically E. coli polar lipids or defined mixtures like POPC:POPE:POPG)

  • Bio-Beads SM-2 or Detergent Removal Resin

  • Buffer components (pH-adjusted to physiological conditions)

Reconstitution protocol:

  • Prepare lipid films by dissolving lipids in chloroform, drying under nitrogen, and rehydrating in buffer

  • Solubilize lipids with the same detergent used for protein purification

  • Mix detergent-solubilized lipids with purified CBO0394 at protein:lipid ratios of 1:50 to 1:200 (w/w)

  • Remove detergent gradually using Bio-Beads or dialysis

  • Verify proteoliposome formation by dynamic light scattering and freeze-fracture electron microscopy

  • Confirm protein incorporation by SDS-PAGE analysis of recovered proteoliposomes

For functional assays, researchers can design experiments similar to those used for other membrane transporters, such as ion gradient-driven transport or counterflow assays using radiolabeled or fluorescently tagged substrates.

What are common challenges in expressing and purifying CBO0394?

Membrane proteins like CBO0394 present several common challenges:

ChallengePotential Solutions
Low expression levels- Optimize codon usage for expression host
- Test different promoters (T7, tac, araBAD)
- Lower induction temperature (16-20°C)
- Consider expression hosts specialized for membrane proteins
Protein aggregation- Screen different detergents (DDM, LMNG, DMNG)
- Add stabilizing agents (glycerol, specific lipids)
- Include protease inhibitors during extraction
- Test fusion partners that enhance solubility (MBP, SUMO)
Poor purity- Implement two-step purification strategy
- Optimize imidazole concentration in wash buffers
- Consider alternative purification tags
- Use size exclusion chromatography as a final purification step
Verification of proper folding- Circular dichroism to assess secondary structure
- Fluorescence-based thermal stability assays
- Limited proteolysis to test for compact folding
- Binding assays for known ligands (e.g., manganese)

Systematic optimization of these parameters is often necessary to obtain sufficient quantities of properly folded, functional protein.

How can researchers assess if recombinant CBO0394 is correctly folded and functional?

Verifying proper folding and function of recombinant CBO0394 requires multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure content consistent with membrane proteins

    • Size-exclusion chromatography profiles showing monodisperse behavior

    • Thermal stability assays using differential scanning fluorimetry

  • Functional verification:

    • Metal binding assays using isothermal titration calorimetry or fluorescence-based approaches

    • Transport assays in proteoliposomes measuring manganese flux

    • Complementation assays in bacterial strains deficient in manganese efflux

  • Membrane insertion verification:

    • Flotation assays using density gradients to confirm membrane association

    • Protease protection assays to verify membrane topology

    • Fluorescence-based approaches to monitor environment-sensitive probes

Establishing reliable functional assays is particularly important, as they provide the most direct evidence that the recombinant protein retains its native activity.

What experimental controls should be included when working with CBO0394?

Robust experimental design for CBO0394 research should include these essential controls:

For expression and purification:

  • Empty vector control processed identically to evaluate background contamination

  • Known well-behaving membrane protein as positive control for expression system

  • Purification of a non-functional mutant (e.g., predicted metal-binding site mutation)

For functional assays:

  • Proteoliposomes without protein to establish baseline leakage/background

  • Heat-denatured CBO0394 to confirm activity is protein-dependent

  • Known inhibitors of metal transporters as specificity controls

  • Alternative divalent metals (Zn2+, Fe2+, Ca2+) to assess transport specificity

For structural studies:

  • Pre-incubation with specific binding partners or substrates to assess conformational changes

  • Compare detergent-solubilized and liposome-reconstituted forms to evaluate native-like behavior

Careful implementation of these controls helps distinguish specific effects related to CBO0394 from artifacts of the experimental system.

How might computational approaches advance our understanding of CBO0394?

Recent advances in computational protein design and modeling offer new opportunities for studying membrane proteins like CBO0394:

The field has seen significant progress in computational workflows for designing proteins that target intramembrane regions . Similar approaches could be adapted to:

  • Model CBO0394 structure: Leverage recent advances in protein structure prediction algorithms like AlphaFold2 to generate detailed structural models of CBO0394.

  • Simulate metal transport: Employ molecular dynamics simulations to model manganese transport through predicted pores or channels in CBO0394.

  • Design CBO0394-targeting proteins: Apply computational design approaches to create proteins that specifically bind to and potentially inhibit CBO0394, similar to approaches used for other membrane targets .

  • Predict functional residues: Use evolutionary coupling analysis and other computational approaches to identify functionally important residues for targeted mutagenesis.

These computational approaches complement experimental work and can guide hypothesis generation for functional studies of CBO0394.

What is the relationship between CBO0394 and bacterial pathogenicity?

While CBO0394's direct role in pathogenicity is not established, metal homeostasis proteins often contribute to bacterial virulence:

  • Metal availability during infection: Host environments typically restrict manganese availability as a defense mechanism. Efficient manganese transport systems may help C. botulinum overcome this nutritional immunity.

  • Stress response: Metal efflux pumps protect bacteria from metal toxicity that may occur during host immune responses (e.g., macrophage oxidative burst).

  • Regulation of virulence factors: In many bacteria, metal-sensing regulatory systems coordinate expression of virulence factors with metal availability. CBO0394 may indirectly affect toxin production through manganese homeostasis.

Investigating these relationships requires experimental approaches like:

  • Generating CBO0394 deletion mutants and assessing virulence in appropriate models

  • Measuring toxin production under varying manganese concentrations

  • Exploring regulatory networks connecting metal homeostasis to virulence factor expression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.