Recombinant Clostridium botulinum UPF0059 membrane protein CBO1290/CLC_1328 (CBO1290, CLC_1328)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference for customers.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP2; CBO1290; CLC_1328; Putative manganese efflux pump MntP 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
Target Names
mntP2
Target Protein Sequence
MDLISVILISIGLSMDAFAVSITNGAMISKVTASEGIRIGLFFGGFQALMPLIGWSIGIK FESYIAALDHWIALILLSIIGGKMIYDSVKENQDHKDEIACDYAAGEKKCLNNKTLILLA IATSIDALAVGVSFAFLKVSIINTIIIIGSITFVICFIGVMIGKKCGKLLKKRAEILGGV VLILIGVKIFIQHTNILSYIF
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links

KEGG: cbh:CLC_1328

Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the UPF0059 membrane protein family and what structural characteristics does CBO1290/CLC_1328 display?

The UPF0059 family comprises uncharacterized membrane proteins with conserved structures found across bacterial species. Based on related proteins like CBO0394, CBO1290/CLC_1328 likely features multiple transmembrane domains characteristic of transport proteins . Analysis suggests these proteins contain hydrophobic regions that span the cell membrane, with a full-length sequence consisting of approximately 180-190 amino acids forming a multi-pass transmembrane structure with both hydrophobic membrane-spanning regions and hydrophilic loop regions .

How do CBO1290/CLC_1328 and similar UPF0059 membrane proteins contribute to bacterial cell function?

UPF0059 membrane proteins likely serve as ion transporters, with related proteins like CBO0394 functioning as putative manganese efflux pumps (MntP) . Research methodology to determine function should include:

  • Gene knockout studies measuring growth under various ionic conditions

  • Metal sensitivity/resistance assays

  • Membrane permeability measurements

  • Comparative genomic analysis with characterized transporters

While specific function remains under investigation, sequence homology with other UPF0059 proteins suggests involvement in metal ion homeostasis critical for bacterial survival.

What expression systems are most effective for recombinant CBO1290/CLC_1328 production?

Based on successful expression of the related UPF0059 protein CBO0394, the following expression system shows optimal results:

Expression ParameterRecommended ConditionNotes
Host SystemE. coliDemonstrated success with related proteins
Vector DesignN-terminal His-tagFacilitates purification without function interference
Growth Temperature16-25°CLower temperatures reduce inclusion body formation
Induction0.1-0.5 mM IPTGGentle induction preserves protein folding
Buffer SystemTris/PBS-based, pH 8.0With 6% trehalose as stabilizer
Storage-20°C/-80°CAliquot to avoid freeze-thaw cycles

Alternative expression systems (insect cells, cell-free) should be considered if E. coli expression yields insufficient functional protein.

What approaches should be used to determine the three-dimensional structure of CBO1290/CLC_1328?

Membrane protein structural determination requires specialized methodologies:

  • Sample preparation optimization:

    • Detergent screening (DDM, LMNG, CHAPS)

    • Lipid nanodisc reconstitution

    • Amphipol stabilization

  • Structure determination techniques prioritization:

    • Cryo-electron microscopy (primary choice for membrane proteins)

    • X-ray crystallography with lipidic cubic phase

    • NMR for dynamic studies of specific domains

  • Computational structure prediction:

    • AlphaFold2/RoseTTAFold modeling

    • Molecular dynamics simulations in membrane environments

    • Structure validation through mutagenesis of key residues

The presence of multiple transmembrane domains makes crystallization challenging, necessitating screening of multiple conditions and possibly protein engineering to introduce crystal contacts while preserving native structure.

How can mass spectrometry approaches be optimized for CBO1290/CLC_1328 characterization?

Advanced mass spectrometry techniques provide crucial insights into membrane protein characteristics:

  • Implement targeted MS approaches with product ion scanning (PIS) MS/MS mode for sensitive detection

  • Apply accurate inclusion mass screening (AIMS) methodology for initial protein identification

  • Utilize iTRAQ-based quantitative proteomic analysis for comparative studies

  • Develop targeted MS assays for specific peptides of interest for verification studies

For post-translational modification analysis:

MS ApproachApplicationData Analysis Strategy
Bottom-up proteomicsSequence coverage, PTM identificationDatabase search with variable modifications
Top-down proteomicsIntact protein analysisDeconvolution algorithms for charge state determination
Crosslinking MSSpatial proximity mappingSpecialized XL-MS search engines
HDX-MSConformational dynamicsDeuterium uptake analysis software

These approaches can reveal functional modifications and structural characteristics not apparent from sequence analysis alone.

What methodologies are most effective for investigating CBO1290/CLC_1328 interactions with other proteins or cellular components?

Membrane protein interaction studies require specialized approaches:

  • In vivo techniques:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Proximity-dependent biotin labeling (BioID, APEX)

    • Fluorescence resonance energy transfer (FRET)

  • In vitro methods:

    • Surface plasmon resonance with reconstituted protein

    • Microscale thermophoresis for weak interactions

    • Pull-down assays with careful detergent selection

  • Computational prediction:

    • Coevolution analysis for interaction interface prediction

    • Molecular docking simulations in membrane environments

    • Network analysis of genomic context and expression correlation

Controls should include non-specific binding assessments and validation across multiple methodologies to distinguish true interaction partners from artifacts.

How should reconstitution experiments be designed to assess CBO1290/CLC_1328 transport function?

Functional reconstitution requires systematic methodological approaches:

  • Liposome preparation optimization:

    • Lipid composition screening (bacterial lipid extracts, synthetic mixtures)

    • Size control through extrusion (100-200 nm vesicles)

    • Internal buffer composition for transport measurements

  • Protein incorporation:

    • Detergent-mediated reconstitution

    • Direct incorporation during liposome formation

    • Oriented insertion validation using protease protection assays

  • Transport assay design:

    • Fluorescent indicators for real-time measurements

    • Radioisotope flux for high sensitivity

    • Ion-selective electrodes for direct concentration measurement

Transport ParameterMeasurement ApproachExpected Outcome
Transport kineticsTime-course measurementsKm, Vmax determination
Ion selectivityCompetitive inhibitionSubstrate preference profile
ElectrogenicityMembrane potential sensorsCharge transfer characteristics
Inhibitor sensitivityDose-response curvesPharmacological profile

These experiments should include appropriate controls (protein-free liposomes, inactive protein mutants) to distinguish specific transport activity.

What strategies should be employed to investigate the regulation of CBO1290/CLC_1328 expression in Clostridium botulinum?

Gene regulation studies require multi-level analysis:

  • Transcriptional regulation:

    • Promoter mapping through 5' RACE

    • Reporter gene assays with promoter truncations

    • ChIP-seq for transcription factor binding

    • RNA-seq under varying environmental conditions

  • Post-transcriptional control:

    • mRNA stability assays

    • Ribosome profiling for translation efficiency

    • sRNA interaction screening

  • Post-translational regulation:

    • Protein half-life determination

    • PTM mapping using targeted MS approaches

    • Activity modulation by cellular factors

This multi-level analysis can reveal condition-specific regulation mechanisms that may connect CBO1290/CLC_1328 function to specific environmental responses in C. botulinum.

How can site-directed mutagenesis be effectively utilized to probe CBO1290/CLC_1328 structure-function relationships?

Systematic mutagenesis approaches provide insights into protein function:

  • Target selection strategies:

    • Conserved residues identified through multiple sequence alignment

    • Predicted transmembrane domains and loop regions

    • Potential metal-binding motifs

    • Charged residues within transmembrane segments

  • Mutation design principles:

    • Conservative substitutions to probe specific interactions

    • Charge reversal to test electrostatic contributions

    • Cysteine scanning for accessibility studies

    • Introduction of reporter groups (fluorescent amino acids)

  • Functional assessment methods:

    • Growth complementation assays in deletion strains

    • Transport activity in reconstituted systems

    • Folding and stability through thermal shift assays

    • Structural perturbation via limited proteolysis

Mutation CategoryExpected EffectAssessment Method
Transmembrane regionAltered transport selectivityIon flux measurements
Potential metal-binding sitesReduced transport capacityMetal binding assays
Conserved charged residuesDisrupted gating mechanismElectrophysiology
Loop regionsAltered regulatory interactionsProtein interaction studies

Results should be interpreted in the context of homology models or experimental structures when available.

What bioinformatic approaches are most valuable for predicting CBO1290/CLC_1328 function?

Comprehensive bioinformatic analysis requires multiple complementary approaches:

  • Sequence-based analysis:

    • Hidden Markov Model searches for remote homologs

    • Transmembrane topology prediction (TMHMM, Phobius)

    • Conserved domain identification (InterPro, PFAM)

    • Functional residue prediction (ConSurf, PROSITE)

  • Structure-based prediction:

    • Homology modeling with membrane protein templates

    • Ab initio structure prediction with membrane constraints

    • Molecular dynamics simulations in lipid bilayers

    • Binding site prediction for potential substrates

  • Genomic context analysis:

    • Gene neighborhood conservation

    • Co-occurrence patterns across bacterial species

    • Phylogenetic profiling for functional associations

This integrated approach can generate testable hypotheses about substrate specificity, transport mechanism, and physiological role within bacterial cells.

How should discrepancies between predictive models and experimental data for CBO1290/CLC_1328 be resolved?

Scientific investigation often reveals contradictions requiring systematic resolution:

  • Data quality assessment:

    • Experimental reproducibility evaluation

    • Statistical power analysis

    • Control adequacy verification

    • Method limitations identification

  • Model refinement strategies:

    • Parameter adjustment based on experimental constraints

    • Alternative model testing and comparison

    • Hybrid approaches incorporating multiple data types

    • Sensitivity analysis to identify critical assumptions

  • Resolution approaches:

    • Targeted experiments to address specific discrepancies

    • Independent method validation

    • Reconciliation through extended model development

    • Consideration of biological variability and heterogeneity

The iterative process of model refinement based on experimental feedback represents the core of scientific advancement in membrane protein research.

What approaches are recommended for integrating structural, functional, and evolutionary data for comprehensive understanding of CBO1290/CLC_1328?

Data integration requires sophisticated methodological approaches:

  • Multi-scale modeling frameworks:

    • Sequence-structure-function relationship mapping

    • Evolutionary constraints incorporation into structural models

    • Functional data as validation for structural predictions

  • Visualization and analysis tools:

    • Structure mapping of evolutionary conservation

    • Functional data projection onto structural models

    • Network analysis of protein-protein interactions

  • Machine learning approaches:

    • Feature extraction from multiple data sources

    • Pattern recognition across diverse datasets

    • Prediction of untested conditions or mutations

This integrated approach can reveal emergent properties not apparent from individual data types and guide future experimental design for comprehensive characterization.

What strategies can overcome challenges in purifying sufficient quantities of functional CBO1290/CLC_1328?

Membrane protein purification presents unique challenges requiring specialized approaches:

  • Solubilization optimization:

    • Systematic detergent screening (non-ionic, zwitterionic)

    • Detergent concentration titration

    • Solubilization time and temperature optimization

    • Addition of specific lipids (cholesterol, cardiolipin)

  • Purification strategy refinement:

    • Gentle elution conditions during affinity chromatography

    • Buffer optimization with stabilizers (trehalose 6%, glycerol)

    • Minimization of exposure to air/oxidation

    • Immediate stabilization post-purification

  • Quality control methods:

    • Size exclusion chromatography for aggregation assessment

    • Circular dichroism for secondary structure verification

    • Thermal stability assays for functional confirmation

    • Limited proteolysis for conformation analysis

Based on experience with related proteins, addition of 6% trehalose in Tris/PBS-based buffer at pH 8.0 significantly enhances stability , while aliquoting and storage at -80°C with 5-50% glycerol prevents degradation during freeze-thaw cycles .

How can protein reconstitution efficiency be optimized for functional studies of CBO1290/CLC_1328?

Effective reconstitution requires systematic optimization:

  • Detergent selection considerations:

    • Detergent CMC and micelle size

    • Compatibility with lipid composition

    • Removal kinetics during reconstitution

  • Lipid composition optimization:

    • Native-like bacterial lipid mixtures

    • Systematic testing of synthetic lipid combinations

    • Investigation of lipid:protein ratios

  • Reconstitution method selection:

    • Detergent removal via dialysis (gentle, complete)

    • Bio-beads adsorption (rapid, efficient)

    • Dilution method (simple, potentially incomplete)

    • Direct incorporation (specialized applications)

Functional verification through transport assays should guide optimization, with attention to protein orientation, which can be assessed through protease accessibility studies or antibody-based approaches targeting known extramembrane domains.

What controls and validation approaches are essential when applying advanced mass spectrometry techniques to CBO1290/CLC_1328 analysis?

Rigorous validation ensures reliable mass spectrometry results:

  • Sample preparation controls:

    • Isotopically labeled internal standards

    • Known quantity spike-ins

    • Procedural blanks to detect contamination

    • Technical and biological replicates

  • Mass spectrometry validation:

    • Multiple peptide detection per protein

    • Orthogonal fragmentation methods

    • Retention time prediction correlation

    • False discovery rate control

  • Data analysis verification:

    • Multiple search engines comparison

    • Manual spectrum verification for critical peptides

    • Statistical evaluation of reproducibility

    • Independent method confirmation for key findings

As demonstrated in the study of extracellular vesicle membrane proteins , targeted MS assay development with careful selection of target peptides enables reliable quantification even in complex biological samples, a methodology directly applicable to CBO1290/CLC_1328 analysis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.