Recombinant Clostridium botulinum UPF0059 membrane protein CLB_1318 (CLB_1318)

Shipped with Ice Packs
In Stock

Description

Functional Insights and Biological Context

CLB_1318 belongs to the manganese efflux pump family (K23242), suggesting involvement in metal ion transport. Manganese homeostasis is critical for bacterial survival, as it participates in antioxidant defenses and enzymatic processes . While direct evidence for CLB_1318’s activity is absent, its classification implies potential roles in:

  • Metal Ion Regulation: Efflux of excess manganese to prevent toxicity.

  • Stress Response: Maintenance of cellular redox balance under oxidative stress.

No studies explicitly link CLB_1318 to botulinum neurotoxin (BoNT) production or pathogenicity, distinguishing it from other C. botulinum proteins like BoNT/A or B .

Recombinant Production and Expression

Recombinant UPF0059 ProteinExpression SystemTagFunction
CBO1290/CLC_1328E. coliN-terminal HisMembrane localization

While CLB_1318’s recombinant production is unconfirmed, His-tagged versions of related UPF0059 proteins are commonly expressed in E. coli for structural or functional studies .

Research Gaps and Future Directions

Key limitations and areas for investigation include:

  • Functional Validation: No experimental data confirm CLB_1318’s role in manganese efflux or bacterial physiology.

  • Structural Elucidation: Crystallization or cryo-EM studies to resolve transmembrane domains and binding sites.

  • Pathogenic Relevance: Potential interactions with BoNT complexes or host immune evasion mechanisms remain unexplored .

Comparative Analysis with Related Proteins

CLB_1318 differs from well-studied C. botulinum components:

ProteinFunctionRole in Pathogenicity
CLB_1318Putative manganese effluxUnknown
BoNT/A (Heavy Chain)Neurotoxin translocation/receptor bindingDirectly causes botulism
Membrane Vesicle ProteinsImmune modulation, toxin deliveryEnhances pathogen persistence

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Please note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoted for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note: The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; CLB_1318; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Clostridium botulinum (strain ATCC 19397 / Type A)
Target Names
mntP
Target Protein Sequence
MDLISVILISIGLSMDAFAVSITNGAMISKVTASEGIRIGLFFGGFQALMPLIGWSIGIK FESYIAALDHWIALILLSIIGGKMIYDSVKENQDHKDEIACDYAAGEKKCLNNKTLILLA IATSIDALAVGVSFAFLKVSIINTIIIIGSITFVICFIGVMIGKKCGKLLKKRAEILGGV VLILIGVKIFIQHTNILSYIF
Uniprot No.

Target Background

Function
This protein is likely involved in manganese efflux.
Database Links

KEGG: cba:CLB_1318

Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Recombinant C. botulinum UPF0059 membrane protein CLB_1318?

The UPF0059 family of membrane proteins includes several homologous proteins across Clostridium species. Based on characterized homologs such as the C. novyi UPF0059 membrane protein (NT01CX_1560), these proteins typically have a full length of approximately 185 amino acids . The protein structure includes multiple transmembrane domains characteristic of membrane transport proteins. While CLB_1318 is specific to C. botulinum, its structural characteristics likely align with those of the characterized UPF0059 family proteins, featuring hydrophobic domains that facilitate membrane integration.

What expression systems are recommended for recombinant production of C. botulinum membrane proteins?

E. coli expression systems are frequently employed for recombinant production of Clostridium proteins, including membrane proteins from C. botulinum. For optimal expression:

  • Select an appropriate E. coli strain optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3))

  • Utilize a vector system containing an N-terminal or C-terminal His-tag for purification purposes

  • Optimize induction conditions (temperature, IPTG concentration, induction time) to prevent inclusion body formation

Comparable UPF0059 membrane proteins have been successfully expressed in E. coli systems with His-tag fusions, suggesting this approach would be suitable for CLB_1318 .

What are the optimal storage conditions for maintaining protein stability?

For recombinant membrane proteins like CLB_1318, proper storage is critical to maintain functional integrity:

Storage ParameterRecommended ConditionNotes
Short-term storage4°CViable for up to one week
Long-term storage-20°C to -80°CAliquoting necessary to avoid freeze-thaw cycles
Buffer compositionTris/PBS-based buffer with 6% Trehalose, pH 8.0Helps maintain protein stability
Glycerol addition5-50% (final concentration)Prevents freeze damage in long-term storage

Repeated freeze-thaw cycles should be strictly avoided as they significantly compromise membrane protein integrity .

What is the recommended reconstitution protocol for lyophilized protein?

For optimal reconstitution of lyophilized CLB_1318 protein:

  • Briefly centrifuge the vial before opening to collect all material at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being standard practice)

  • Aliquot the reconstituted protein for long-term storage at -20°C/-80°C

  • Validate protein integrity after reconstitution through SDS-PAGE analysis

How can researchers effectively validate the purity and identity of recombinant CLB_1318?

Comprehensive validation requires multiple analytical approaches:

  • SDS-PAGE Analysis: Confirm a single band at the expected molecular weight (~20 kDa based on amino acid sequence)

  • Western Blot Analysis: Utilize anti-His antibodies for tag detection or specific antibodies against the protein

  • Mass Spectrometry: Perform peptide mass fingerprinting to confirm sequence identity

  • Circular Dichroism: Assess secondary structure composition to confirm proper protein folding

  • Size Exclusion Chromatography: Evaluate protein homogeneity and oligomeric state

Protein purity should exceed 90% as determined by SDS-PAGE for most research applications .

What approaches are recommended for functional characterization of CLB_1318?

Functional characterization of CLB_1318 should incorporate multiple complementary techniques:

  • Proteoliposome Reconstitution: Incorporate purified protein into artificial lipid bilayers to study transport properties

  • Membrane Potential Assays: Utilize fluorescent dyes to assess effects on membrane potential

  • Isothermal Titration Calorimetry: Determine binding affinities for potential substrates

  • Site-Directed Mutagenesis: Systematically modify key residues to identify functional domains

  • Comparative Analysis: Compare functions with homologous proteins such as the putative manganese efflux pump MntP in related species

How can CRISPR-Cas9 gene editing be applied to study CLB_1318 expression and function?

CRISPR-Cas9 provides powerful tools for genetic manipulation of C. botulinum:

  • Gene Knockout Strategy: Design a CRISPR-Cas9 system targeting CLB_1318 with a "bookmark" approach that introduces a unique 24-nt sequence to facilitate subsequent complementation

  • Bookmark-Complementation Method: Utilize the inserted bookmark sequence as an sgRNA target for Cas9 to replace mutant alleles with functional copies

  • Watermarking for Strain Identification: Introduce silent mutations in complemented genes to create a "watermark" that distinguishes them from wild-type sequences

  • Phenotypic Analysis: Compare wild-type, mutant, and complemented strains to establish protein function

This system allows for precise genetic manipulation without polar effects on downstream genes compared to earlier insertional mutagenesis methods like ClosTron .

What strategies can overcome challenges in membrane protein crystallization for structural studies?

Membrane protein crystallization presents significant challenges that can be addressed through:

  • Detergent Screening: Systematically test multiple detergent types (maltosides, glucosides, etc.) at varying concentrations

  • Lipidic Cubic Phase (LCP) Crystallization: Utilize LCP approaches which better mimic the native membrane environment

  • Fusion Protein Strategies: Create fusion constructs with crystallization chaperones such as T4 lysozyme

  • Surface Entropy Reduction: Identify and mutate surface residues with high conformational entropy

  • Nanobody Co-crystallization: Generate specific nanobodies as crystallization aids

How should researchers optimize purification protocols specifically for CLB_1318?

A comprehensive purification strategy involves multiple refined steps:

StepMethodPurposeCritical Parameters
1Membrane isolationSeparate membrane fractionBuffer composition, centrifugation speed
2SolubilizationExtract membrane proteinDetergent selection, protein:detergent ratio
3IMAC purificationCapture His-tagged proteinImidazole concentration, flow rate
4Size exclusionRemove aggregatesColumn selection, buffer composition
5Quality controlAssess purity and activityMultiple analytical techniques

For optimal results, perform a detergent screening to identify conditions that maintain native protein conformation while efficiently extracting from membranes.

How can metadata deduplication techniques improve CLB_1318 homology analysis across Clostridium species?

When comparing CLB_1318 with homologous proteins across Clostridium species:

  • Implement metadata deduplication that resolves duplicate entries describing the same protein

  • Establish matching criteria based on sequence similarity, structural domains, and functional motifs

  • Enrich metadata entries with missing fields using data from different schemas

  • Prioritize high-quality data sources (like curated databases) for final determinations when conflicts occur

This approach effectively identifies true evolutionary relationships between UPF0059 family members, avoiding artificially inflated diversity due to duplicate entries in databases.

What are the methodological considerations for antibody development against CLB_1318?

Development of specific antibodies requires careful planning and validation:

  • Epitope Selection: Choose unique regions of CLB_1318 with low homology to other proteins

  • Cross-reactivity Testing: Validate specificity against other botulinum toxin components and related Clostridial proteins

  • Application Optimization: Determine optimal conditions for each application (Western blot, ELISA, immunocytochemistry)

  • Validation Controls: Include appropriate positive and negative controls, including other Clostridium membrane proteins

When developing antibodies, it's essential to validate there is no cross-reactivity with other Clostridial proteins to ensure experimental specificity .

How should sporulation media selection be considered when studying membrane protein expression patterns?

The study of CLB_1318 expression during different growth phases, including sporulation, requires careful media selection:

  • Evaluate protein expression in multiple media formulations, including specialized sporulation media like CMM-TPGY

  • Compare expression patterns between vegetative growth (TPGY) and sporulation-inducing conditions

  • Consider biphasic media systems which better support the transition to sporulation in Clostridium species

  • Monitor protein expression at multiple time points (1 day, 1 week, 2 weeks) to capture phase-dependent expression patterns

Research has demonstrated that different Clostridium strains show variable sporulation efficiency in different media formulations, which could affect membrane protein expression patterns .

How can researchers address protein aggregation issues during CLB_1318 purification?

Protein aggregation represents a common challenge with membrane proteins that can be addressed through:

  • Buffer Optimization: Screen different buffer compositions, focusing on pH, salt concentration, and stabilizing additives

  • Detergent Selection: Test multiple detergent types and concentrations to identify optimal solubilization conditions

  • Temperature Control: Maintain strict temperature control during all purification steps, typically performing at 4°C

  • Addition of Stabilizers: Incorporate glycerol, trehalose, or specific lipids that maintain protein stability

  • Avoiding Concentration Issues: Utilize controlled concentration methods and monitor aggregation through dynamic light scattering

What approaches can resolve contradictory functional data when comparing CLB_1318 with homologous UPF0059 proteins?

When faced with contradictory data about protein function:

  • Systematically compare experimental conditions used in different studies

  • Evaluate the impact of tags and fusion partners on protein function

  • Consider species-specific differences in membrane composition and cellular physiology

  • Perform direct comparative studies under identical conditions

  • Utilize complementation studies to validate functional conservation between homologs

The CRISPR-Cas9 bookmark approach offers an effective method for generating knockout and complemented strains to resolve such contradictions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.