Recombinant Clostridium botulinum UPF0059 membrane protein CLI_1375 (CLI_1375)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
mntP2; CLI_1375; Putative manganese efflux pump MntP 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Target Names
mntP2
Target Protein Sequence
MDLISVILISIGLSMDAFAVSITNGAMISKVTASEGIRIGLFFGGFQALMPLIGWSIGIK FESYIAALDHWIALILLSIIGGKMIYDSVKENQDHKDEIACDYAVGEKKCLNNKTLILLA IATSIDALAVGVSFAFLKVSIINTIVIIGSITFVICFIGVMIGKKCGKLLKKRAEILGGV VLILIGVKIFIQHTNILSYIF
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links

KEGG: cbf:CLI_1375

Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for producing CLI_1375, and what yields can researchers expect?

Based on current research protocols, E. coli is the preferred expression system for CLI_1375 recombinant protein production . When optimizing expression, researchers should consider:

  • Expression vector selection: Vectors containing T7 or similar strong promoters with His-tag fusion capability yield better control over expression

  • Expression conditions: Induction at OD600 of 0.6-0.8 with IPTG concentrations of 0.1-1.0 mM

  • Growth temperature: Post-induction growth at lower temperatures (16-25°C) often improves the proper folding of membrane proteins

  • Expected yields: Typically 1-5 mg of purified protein per liter of bacterial culture

For membrane proteins like CLI_1375, expression in specialized E. coli strains (C41/C43 or Lemo21) that are tolerant to membrane protein overexpression can significantly improve yields. Addition of specific detergents during cell lysis and purification is essential for maintaining protein stability and functionality .

How should researchers design experimental protocols for evaluating CLI_1375's function?

When designing experiments to evaluate CLI_1375's function, consider implementing a systematic approach that combines molecular, biochemical, and cellular techniques:

  • Phenotypic analysis of deletion mutants: Create CLI_1375 knockout strains and assess phenotypic changes in:

    • Manganese tolerance/sensitivity

    • Growth curves under varying metal ion concentrations

    • Membrane integrity

    • Stress response

  • Metal ion transport assays: Measure manganese uptake/efflux in proteoliposomes reconstituted with purified CLI_1375 protein

  • Site-directed mutagenesis: Identify critical residues by introducing point mutations in conserved domains and evaluating functional changes

  • Complementation studies: Express CLI_1375 in heterologous systems lacking manganese transporters to confirm functional conservation

  • Bioinformatic analysis: Perform comparative genomics with other bacterial manganese transporters to predict functional domains

When conducting these experiments, control for environmental variables including pH, temperature, and metal ion concentrations that might affect protein function. Contradictory results often emerge from variations in these parameters, so maintaining strict controls is essential .

What purification strategies yield the highest purity and activity for recombinant CLI_1375?

Purification of membrane proteins like CLI_1375 requires specialized approaches to maintain structural integrity and function:

Recommended purification protocol:

  • Cell lysis and membrane fraction isolation:

    • Lyse cells using a combination of enzymatic (lysozyme) and mechanical methods

    • Isolate membrane fractions through differential centrifugation

    • Solubilize membranes with appropriate detergents (e.g., DDM, LDAO, or Triton X-100)

  • Affinity chromatography:

    • Utilize the N-terminal His-tag for IMAC (Immobilized Metal Affinity Chromatography)

    • Use buffers containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 20 mM imidazole, and 0.05% detergent

    • Elute with increasing imidazole gradient (50-500 mM)

  • Further purification:

    • Size exclusion chromatography to remove aggregates and obtain homogeneous protein populations

    • Ion exchange chromatography to separate different charged species

  • Quality assessment:

    • SDS-PAGE for purity (>90% purity is typically achievable)

    • Western blotting for identity confirmation

    • Mass spectrometry for accurate molecular weight determination

    • Circular dichroism for secondary structure analysis

For optimal results, maintain detergent concentrations above critical micelle concentration throughout the purification process and consider adding stabilizers like glycerol (5-10%) to buffers .

How can CLI_1375 research benefit from structural biology approaches?

Structural characterization of CLI_1375 can significantly advance understanding of its function through several methodological approaches:

  • X-ray crystallography workflow:

    • Screen various detergents (DDM, LDAO, C12E8) to identify optimal conditions for crystal formation

    • Utilize lipidic cubic phase crystallization techniques that better accommodate membrane proteins

    • Consider fusion partners (e.g., T4 lysozyme) to increase soluble domains for crystal contacts

    • Data collection at synchrotron radiation facilities with cryo-protection

  • Cryo-electron microscopy (Cryo-EM):

    • Particularly valuable for membrane proteins difficult to crystallize

    • Reconstitution in nanodiscs rather than detergent micelles to maintain native-like environment

    • Single-particle analysis to determine 3D structure

    • Requires minimal sample amount compared to crystallography

  • Nuclear Magnetic Resonance (NMR):

    • Isotope labeling (15N, 13C) for structural determination

    • Particularly useful for studying dynamic regions and protein-ligand interactions

    • Solution and solid-state NMR complementary approaches for membrane proteins

  • Molecular dynamics simulations:

    • Model CLI_1375 in lipid bilayers to understand conformational changes

    • Predict ion translocation pathways and binding sites

    • Simulate interactions with potential binding partners

These approaches would help identify key functional regions, binding pockets, and conformational changes associated with CLI_1375's putative transport function, potentially revealing therapeutic targets against C. botulinum .

What are the methodological considerations for studying CLI_1375's role in C. botulinum pathogenesis?

When investigating CLI_1375's potential role in C. botulinum pathogenesis, researchers should employ a comprehensive approach that addresses several methodological considerations:

  • Gene expression analysis:

    • RT-qPCR to measure CLI_1375 expression under various conditions (nutrient limitation, host-like environments)

    • RNA-seq to determine co-regulated genes and operons

    • Promoter-reporter fusions to monitor expression in real-time

  • Genetic manipulation strategies:

    • CRISPR-Cas9 based gene editing (challenging in Clostridium species)

    • Antisense RNA approaches for gene silencing

    • Consider tetracycline-inducible expression systems for controlled gene expression

  • Infection models:

    • In vitro cell culture models using neural cell lines (relevant to botulism)

    • Ex vivo tissue culture systems

    • Animal models with appropriate ethical considerations

  • Data validation and analysis:

    • Control for anaerobic growth conditions specific to Clostridium species

    • Account for strain variations in C. botulinum

    • Apply statistical methods appropriate for the experimental design (ANOVA, regression analysis)

  • Translational relevance assessment:

    • Compare findings with clinical isolates

    • Evaluate potential as a biomarker or diagnostic target

This methodological framework allows for systematic investigation while addressing the unique challenges of working with anaerobic pathogens like C. botulinum .

How does CLI_1375 compare with similar membrane proteins in other Clostridium species?

A comparative analysis of CLI_1375 with homologous proteins in other Clostridium species reveals important evolutionary and functional insights:

Table 1: Comparative Analysis of CLI_1375 Homologs Across Clostridium Species

SpeciesProtein IDSequence Identity (%)Key Structural DifferencesPredicted Function
C. botulinumCLI_1375100Reference sequencePutative Mn²⁺ efflux
C. tetaniCTC_0137578.2Extended N-terminal domainMetal ion transport
C. perfringensCPF_124365.7Variant in transmembrane domain 3Cation transport
C. difficileCD630_1265061.3Altered metal binding motifsIon homeostasis
C. novyiCNT_164259.8Mutations in conserved residuesUnclear

When conducting comparative genomic analyses:

  • Utilize multiple sequence alignments with MUSCLE or CLUSTALW algorithms

  • Employ phylogenetic tree construction to understand evolutionary relationships

  • Perform synteny analysis to identify conserved genomic context

  • Analyze selection pressure (dN/dS ratios) on different protein domains

These analyses can help researchers determine whether CLI_1375 functions are universally conserved or have undergone specialization in C. botulinum, potentially contributing to its unique pathogenicity profile .

How can CLI_1375 research benefit from integration with studies on BoNT (Botulinum Neurotoxin) production?

Integrating CLI_1375 research with BoNT production studies presents significant opportunities for understanding C. botulinum pathogenesis holistically:

  • Regulatory networks investigation:

    • Determine if CLI_1375 expression correlates with BoNT production phases

    • Identify common transcriptional regulators using ChIP-seq or similar approaches

    • Assess if environmental triggers for BoNT production affect CLI_1375 expression

  • Metal homeostasis and toxin production:

    • Evaluate if manganese levels regulated by CLI_1375 influence BoNT synthesis

    • Metal ions, particularly zinc, are essential for BoNT activity as zinc metalloproteases

    • Design experiments to manipulate CLI_1375 expression and measure effects on BoNT levels

  • Experimental design for integrated studies:

    • Time-course experiments capturing both membrane protein expression and toxin production

    • Multi-omics approaches (transcriptomics, proteomics, metabolomics)

    • Environmental condition matrices varying both metal availability and toxin-inducing factors

  • Data integration methods:

    • Network analysis to identify potential interactions

    • Machine learning approaches to identify patterns in complex datasets

    • Systems biology models incorporating both membrane transport and toxin production pathways

This integrated approach could reveal whether CLI_1375 contributes to creating optimal cellular conditions for BoNT production and provide insights into novel therapeutic strategies targeting multiple aspects of C. botulinum pathogenesis .

How should researchers address contradictory results when studying CLI_1375 function?

When confronted with contradictory results in CLI_1375 functional studies, researchers should implement a systematic troubleshooting approach:

  • Methodological validation:

    • Verify protein identity through mass spectrometry or N-terminal sequencing

    • Confirm proper folding using circular dichroism or limited proteolysis

    • Assess oligomerization state using native PAGE or size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

  • Experimental condition analysis:

    • Create a data table documenting all variables across experiments:

    Table 2: Experimental Condition Documentation for Contradictory Results Resolution

    VariableExperiment 1Experiment 2Experiment 3Potential Impact
    Expression systemE. coli BL21E. coli C43P. pastorisFolding, PTMs
    Detergent typeDDMLDAODigitoninStructural integrity
    Buffer compositionHEPES pH 7.5Tris pH 8.0Phosphate pH 7.0Activity, stability
    Metal ions presentZn²⁺, Mg²⁺Mn²⁺, Mg²⁺EDTA addedCofactor requirements
    Temperature25°C37°C4°CConformational states
    Protein concentration0.1 mg/mL1.0 mg/mL0.5 mg/mLAggregation state
  • Systematic parameter variation:

    • Design a factorial experiment varying key parameters

    • Implement statistical analysis methods such as ANOVA to identify significant variables

    • Control for batch-to-batch variations in protein preparations

  • Alternative methodological approaches:

    • If functional assays give contradictory results, employ orthogonal techniques

    • Consider in vivo vs. in vitro discrepancies and their biological relevance

    • Evaluate whether detergent-solubilized protein behavior differs from membrane-embedded behavior

  • Collaborative verification:

    • Engage independent laboratories to verify key findings

    • Standardize protocols across research groups

    • Conduct blind analyses to minimize bias

What experimental design is recommended for evaluating CLI_1375's potential as a therapeutic target?

Evaluating CLI_1375 as a potential therapeutic target requires a comprehensive experimental design that progresses from target validation to preclinical testing:

  • Target validation phase:

    • Generate conditional knockdown systems in C. botulinum to confirm essentiality

    • Perform complementation studies with mutant variants to identify critical residues

    • Develop high-throughput screening assays specific to CLI_1375 function

  • Inhibitor discovery approaches:

    • Structure-based virtual screening if structural data is available

    • Fragment-based screening using NMR or thermal shift assays

    • High-throughput biochemical assays (e.g., ATPase activity if relevant)

    • Phenotypic screening against C. botulinum growth

  • Mechanistic studies of lead compounds:

    • Binding affinity determination using isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR)

    • Structural studies of protein-inhibitor complexes

    • Site-directed mutagenesis to confirm binding site predictions

    • Competition assays with natural substrates/ligands

  • Efficacy evaluation:

    • Minimum inhibitory concentration (MIC) determination against various C. botulinum strains

    • Time-kill kinetics assays

    • Effect on BoNT production levels

    • Synergy testing with existing antibiotics

  • Preliminary safety assessment:

    • Cytotoxicity against mammalian cell lines

    • Selectivity against human homologs

    • Off-target activity screening

    • Basic ADME (absorption, distribution, metabolism, excretion) properties

This systematic approach allows for comprehensive evaluation of CLI_1375 as a therapeutic target while generating fundamental knowledge about its biological function. Consider implementing a stage-gate decision process to efficiently allocate resources throughout the research pipeline .

How can CLI_1375 research benefit from integration with chimeric protein and vaccine development approaches?

Research on CLI_1375 could potentially leverage chimeric protein and vaccine development approaches similar to those used with other C. botulinum proteins:

  • Chimeric protein design strategies:

    • Fusion of CLI_1375 immunogenic epitopes with carrier proteins or adjuvants

    • Creation of chimeric constructs with well-characterized membrane domains to improve expression

    • Design considerations from successful chimeric vaccines against botulinum neurotoxins

  • Methodological approaches from BoNT vaccine development:

    • Bivalent vaccine designs as demonstrated with recombinant C1 and D Hc vaccines

    • Expression systems optimization (Pichia pastoris vs. E. coli for different constructs)

    • Adjuvant combinations (e.g., aluminum hydroxide plus immunostimulatory molecules)

  • Experimental design template based on successful approaches:

    • Identification of immunogenic regions through epitope mapping

    • Expression and purification optimization of chimeric constructs

    • Immunization protocols with appropriate dosing and timing

    • Challenge models to assess protective efficacy

  • Innovative integration options:

    • Consider CLI_1375 epitopes as additional components in multi-valent BoNT vaccines

    • Evaluate potential of CLI_1375-based constructs as delivery vehicles for BoNT epitopes

    • Investigate membrane-anchored presentation of BoNT epitopes using CLI_1375 domains

These approaches would build upon established success in recombinant fusion vaccine development against botulinum neurotoxins while exploring novel applications specific to membrane protein-based constructs .

What emerging technologies could advance CLI_1375 research in the next five years?

Several emerging technologies show particular promise for advancing CLI_1375 research:

  • Advanced structural biology techniques:

    • Cryo-electron tomography for visualization of CLI_1375 in native membrane environments

    • Micro-electron diffraction (MicroED) for structural determination from nanocrystals

    • Integrative structural biology combining multiple data sources (SAXS, NMR, and cryo-EM)

  • Membrane protein-specific methodologies:

    • Nanodiscs and styrene-maleic acid lipid particles (SMALPs) for detergent-free purification

    • Cell-free expression systems optimized for membrane proteins

    • Native mass spectrometry techniques for intact membrane protein complexes

  • Genetic and cellular tools:

    • CRISPR interference (CRISPRi) for fine-tuned expression modulation in C. botulinum

    • Advanced inducible gene expression systems for Clostridium species

    • Organoid models incorporating neural cell types for botulism studies

  • Computational approaches:

    • Deep learning protein structure prediction specifically trained on membrane proteins

    • Advanced molecular dynamics simulations with enhanced sampling techniques

    • Systems biology models integrating multi-omics data

  • High-throughput and single-cell technologies:

    • Single-cell transcriptomics to identify heterogeneity in C. botulinum populations

    • Microfluidic approaches for rapid phenotypic screening

    • Label-free detection methods for monitoring membrane protein activity

Researchers should design experiments that can leverage these emerging technologies while maintaining compatibility with established approaches. This ensures both innovation and comparability with existing literature .

What are the key considerations for researchers beginning work with CLI_1375?

Researchers beginning work with CLI_1375 should consider these essential guidelines:

  • Expression and purification considerations:

    • Select appropriate expression systems (E. coli C43/C41 strains recommended)

    • Use mild detergents (DDM or LMNG) for extraction and purification

    • Include stabilizing additives (glycerol 5-10%, specific lipids)

    • Verify protein integrity through multiple analytical methods

  • Experimental design priorities:

    • Establish reliable functional assays before proceeding to complex experiments

    • Document all experimental conditions meticulously

    • Implement appropriate controls for membrane protein work

    • Develop standardized protocols to ensure reproducibility

  • Interdisciplinary approach recommendations:

    • Combine structural, functional, and computational methods

    • Consider evolutionary context through comparative genomics

    • Integrate findings with broader C. botulinum biology

    • Collaborate with specialists in membrane protein biochemistry

  • Common pitfalls to avoid:

    • Detergent-induced artifacts in functional assays

    • Protein aggregation during concentration steps

    • Over-interpretation of in vitro findings without cellular validation

    • Neglecting the impact of expression tags on protein function

By addressing these considerations from the outset, researchers can establish robust experimental frameworks for studying CLI_1375 and contribute meaningful advances to understanding C. botulinum membrane biology .

How should research findings on CLI_1375 be evaluated in the context of C. botulinum pathogenesis?

When evaluating CLI_1375 research findings in the context of C. botulinum pathogenesis, researchers should implement this assessment framework:

  • Contextual evaluation criteria:

    • Relevance to pathogenesis stages (colonization, toxin production, persistence)

    • Connection to established virulence mechanisms

    • Contribution to bacterial survival under host conditions

    • Potential interaction with known virulence factors

  • Data integration methodology:

    • Correlate CLI_1375 expression with toxin production phases

    • Examine phenotypic effects of CLI_1375 modulation on virulence

    • Position findings within established models of C. botulinum pathogenesis

    • Consider temporal and spatial aspects of expression during infection

  • Validation through multiple approaches:

    • In vitro biochemical studies

    • Cellular models of infection

    • Animal models when ethically justified

    • Correlation with clinical isolate characteristics

  • Translational potential assessment:

    • Evaluate as diagnostic biomarker

    • Consider as therapeutic target

    • Assess as vaccine component

    • Examine as virulence predictor

This framework ensures that research on CLI_1375, a comparatively understudied protein, can be meaningfully integrated into the broader understanding of C. botulinum pathogenesis, potentially revealing novel aspects of the organism's biology and pathogenic mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.