Recombinant Clostridium botulinum UPF0059 membrane protein CLK_0733 (CLK_0733)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Clostridium botulinum UPF0059 Membrane Protein CLK_0733

Recombinant Clostridium botulinum UPF0059 membrane protein CLK_0733 (CBO1290/CLC_1328) is a full-length membrane-associated protein expressed in Escherichia coli. This protein is derived from C. botulinum, a Gram-positive, anaerobic spore-forming bacterium responsible for botulism, and is characterized by its role in membrane structure and function. The recombinant form includes an N-terminal His tag (6xHis) for purification and detection, enabling its use in structural, functional, and immunological studies .

Gene and Protein Attributes

ParameterSpecification
Gene IDUPF0059 (CBO1290/CLC_1328)
Protein Length1–201 amino acids
Host OrganismE. coli
Purification MethodNickel affinity chromatography (via His tag)
TagN-terminal His tag (6xHis)
ApplicationsStructural studies, membrane protein interaction assays, vaccine development

The protein’s full-length structure suggests its involvement in membrane integrity or transport processes, though specific functional data remain limited. Membrane proteins like CLK_0733 are critical for bacterial survival, particularly in spore-forming organisms like C. botulinum, which face extreme environmental stresses .

Production and Purification

The recombinant protein is produced in E. coli under optimized conditions, leveraging the organism’s robust protein expression systems. Key steps include:

  1. Cloning: Insertion of the UPF0059 gene into an expression vector.

  2. Expression: Induction of protein synthesis in E. coli cultures.

  3. Purification: Affinity chromatography using nickel columns to isolate the His-tagged protein .

StepDetails
Expression HostE. coli (BL21(DE3) or similar strains)
YieldVaries by batch; typically >1 mg/L for soluble proteins
Purity>90% as confirmed by SDS-PAGE and Western blotting
Storage-80°C in lyophilized or liquid form (buffer: PBS/Tris-HCl)

Membrane Protein Studies

CLK_0733’s recombinant form enables investigations into C. botulinum membrane dynamics, including:

  • Protein-Protein Interactions: Co-immunoprecipitation assays to identify binding partners .

  • Structural Analysis: Cryo-EM or X-ray crystallography to resolve tertiary structure .

  • Immunogenicity: Use as an antigen in antibody production for diagnostic or therapeutic applications .

While direct studies on CLK_0733 are sparse, related C. botulinum membrane proteins (e.g., spore coat proteins) are known to influence spore germination and toxin production .

Comparative Analysis with Related Proteins

ProteinSourceFunctionTagApplications
CLK_0733C. botulinumMembrane structure/transport6xHisStructural studies, immunology
Botulinum NeurotoxinC. botulinumNeurotoxin productionNoneVaccine development, toxin research
mTNFαHumanImmune signalingNoneDrug development, binding assays

CLK_0733 differs from neurotoxins (e.g., BoNT/A) in lacking enzymatic activity but shares membrane localization with other C. botulinum proteins involved in pathogenesis .

Challenges and Future Directions

  1. Functional Elucidation: Limited data on CLK_0733’s role in C. botulinum physiology necessitate further studies using CRISPR-Cas9 mutagenesis or gene knockouts .

  2. Toxin-Spore Interactions: Investigating links between membrane proteins and neurotoxin production during spore germination .

  3. Vaccine Potential: Assessing immunogenicity of CLK_0733 as a subunit vaccine candidate.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage state, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
mntP; CLK_0733; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Clostridium botulinum (strain Loch Maree / Type A3)
Target Names
mntP
Target Protein Sequence
MDLVSIILISIGLSMDAFAVSITNGAMISKVTASEGIRIGLFFGGFQALMPLIGWSIGIK FESYIAALDHWIALILLSIIGGKMIYDSIKENRDNKDEIACDYAVGEKKCLNNKTLTLLA IATSIDALAIGVSFAFLKVSIINTIIIIGSITFVICFIGVMIGKKCGKLLKKRAEILGGI VLIFIGIKIFIEHTNILSKIF
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links

KEGG: cbl:CLK_0733

Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0059 membrane protein CLK_0733 and how does it relate to other C. botulinum proteins?

UPF0059 membrane protein CLK_0733 is an uncharacterized protein family member found in Clostridium botulinum. While specific functional data remains limited, sequence analysis suggests it shares structural similarities with other bacterial membrane proteins. Comparative analysis with botulinum neurotoxins (BoNTs) indicates that as a membrane protein, CLK_0733 may play a role in cellular processes related to toxin production or transport .

Phylogenetic analysis demonstrates that C. botulinum membrane proteins show considerable genetic diversity across strains. The 15-locus MLVA (multilocus variable-number tandem-repeat analysis) system has identified 86 distinct genotypes among C. botulinum group I strains . CLK_0733 classification within this diversity framework provides important context for understanding its evolutionary significance.

What expression systems are most effective for producing recombinant CLK_0733?

E. coli expression systems have proven successful for various C. botulinum proteins, including neurotoxin components . For CLK_0733 expression, researchers should consider:

Expression SystemAdvantagesConsiderations
E. coli- Well-established protocols
- High yield potential
- Compatible with N-terminal tags (e.g., 6-His)
- May form inclusion bodies
- Membrane insertion challenges
- May require detergent solubilization
Specialized E. coli strains (C41/C43)- Engineered for membrane protein expression
- Reduced toxicity
- Lower yields than standard strains
Cell-free systems- Direct incorporation of detergents/lipids
- Avoids toxicity issues
- Higher cost
- Lower scalability

Optimal expression conditions for C. botulinum proteins typically include induction with 1 mM IPTG when cultures reach OD₆₀₀ of 0.6, followed by cell harvesting and resuspension in appropriate buffers (e.g., 150 mM PBS [pH 7.2], 0.5 M NaCl, 20 mM imidazole) .

What purification strategies overcome the challenges specific to CLK_0733?

Membrane proteins like CLK_0733 present unique purification challenges compared to soluble proteins. Based on successful approaches with other C. botulinum membrane-associated proteins, the following protocol is recommended:

  • Cell lysis via sonication (3-minute cycles with 5-second pulses and 2-second breaks)

  • Initial separation of soluble proteins

  • Treatment of inclusion body fraction with mild detergents (0.5% sodium lauryl sarcosine)

  • Overnight stirring at 4°C to solubilize membrane proteins

  • Affinity chromatography using His-tag binding

  • Size exclusion chromatography for final purification

Detergent screening is crucial for maintaining protein structure and function throughout the purification process. The incorporation of membrane mimetics (nanodiscs or liposomes) during later purification stages may help maintain native conformation.

What analytical methods provide the most informative structural data for CLK_0733?

Multiple complementary approaches should be employed for comprehensive structural characterization:

MS-based approaches have been successfully applied to other botulinum proteins, achieving sequence coverages of >60% for toxin components . For CLK_0733, both QTof-Premier and LTQ-Orbitrap instruments can be utilized with nanoLC separation to maximize protein identification and characterization .

How can researchers effectively assess membrane localization and topology of CLK_0733?

Membrane localization and topology studies are critical for understanding CLK_0733 function. Proven methodologies include:

  • Fluorescence microscopy using membrane markers such as wheat germ agglutinin (WGA) and fluorescently-labeled antibodies against CLK_0733

  • Membrane partitioning assays using sucrose cushion (6%) centrifugation to separate aqueous and detergent phases

  • Protease protection assays to determine exposed vs. protected domains

  • Membrane lipid array binding assays to identify specific lipid interactions

For membrane lipid interaction studies, nitrocellulose membrane strips coated with various membrane lipids should be incubated with purified CLK_0733 (1 μg/ml) for 1 hour, followed by antibody detection and development with appropriate substrates .

What methods can determine if CLK_0733 interacts with botulinum neurotoxin components?

To investigate potential interactions between CLK_0733 and botulinum neurotoxin components, researchers should employ multiple complementary approaches:

  • Co-immunoprecipitation using antibodies against CLK_0733 or toxin components

  • Pull-down assays with tagged recombinant proteins

  • Surface plasmon resonance for quantitative binding kinetics

  • Crosslinking coupled with mass spectrometry to identify interaction sites

Interaction studies with botulinum neurotoxin domains have successfully used inhibition assays where potential binding partners are pre-incubated with synaptosomes before adding labeled toxin components . This approach could be adapted to investigate CLK_0733 interactions by pre-incubating synaptosomes with varying concentrations of purified CLK_0733 before adding labeled toxin components.

What detection methods offer optimal sensitivity for CLK_0733 in complex biological samples?

Both immunological and mass spectrometry-based methods provide sensitive detection options:

Detection MethodDetection LimitAdvantagesLimitations
ELISALow ng/ml range- High-throughput
- Quantitative
Requires specific antibodies
Western blottingMid ng range- Size confirmation
- Semi-quantitative
Less sensitive than ELISA
LC-MS/MS (MRM)Low pg range- High specificity
- No antibody required
Requires specialized equipment
ImmunofluorescenceN/A- Spatial information
- In situ detection
Qualitative rather than quantitative

ELISA-based detection of CLK_0733 has been commercially developed , suggesting viable antibodies exist for this protein. For MS-based detection, nanoLC-MS/MS using an Eksigent 2D nanoLC system coupled to an LTQ-Orbitrap has been successfully applied to other C. botulinum proteins . The LC separation should employ a 365 μm × 75 μm fused silica capillary packed with 5 μm Symmetry 300 reverse phase material, with gradient elution over 120 minutes at a flow rate of 400 nl/min .

How can genetic manipulation approaches elucidate CLK_0733 function?

Genetic manipulation provides powerful tools for understanding protein function in a biological context:

  • Gene knockout studies using homologous recombination or CRISPR-Cas9 to assess phenotypic changes

  • Expression of tagged versions for localization and interaction studies

  • Site-directed mutagenesis of conserved residues to identify functional domains

  • Domain swapping experiments with related proteins to determine specificity

Multilocus variable-number tandem-repeat analysis (MLVA) has been successfully applied to C. botulinum genotyping and can provide context for genetic manipulation studies by establishing strain relationships. The 15-locus MLVA scheme allows researchers to position their laboratory strains within the broader context of C. botulinum diversity.

What in vitro functional assays can assess potential roles of CLK_0733 in pathogenicity?

Without established functional data for CLK_0733, researchers should employ exploratory assays based on common membrane protein functions:

Functional AssayPurposeTechnical Approach
Transport assaysAssess potential transporter functionLiposome reconstitution with fluorescent substrates
Lipid binding assaysIdentify specific membrane interactionsMembrane lipid strips with purified protein
Pore formation assaysDetect channel-forming capabilityPlanar lipid bilayer electrophysiology
Toxin inhibition studiesTest effects on toxin activityPreincubation of CLK_0733 with toxin components

Inhibition assays with botulinum neurotoxins have demonstrated that certain protein domains can substantially inhibit toxin binding to synaptosomes . Similar approaches could determine if CLK_0733 influences toxin binding or translocation across membranes.

How might CLK_0733 contribute to botulinum toxin countermeasure development?

If CLK_0733 plays a role in toxin production, stability, or transport, it could represent a novel target for botulism countermeasures:

  • Inhibitory antibodies or peptides targeting CLK_0733 could disrupt toxin production or secretion

  • Small molecule inhibitors might interfere with CLK_0733 function without affecting host proteins

  • CLK_0733 detection could serve as a biomarker for C. botulinum presence in clinical or environmental samples

Peptide-based inhibition strategies have shown promise with botulinum neurotoxin domains . The H₇₂₉₋₈₄₅ peptide from the H₁ domain substantially inhibited BoNT/A binding to synaptosomes, suggesting that targeted peptides can effectively disrupt toxin-related processes .

How can structural studies of CLK_0733 inform comparative analyses of Clostridium species?

Structural characterization of CLK_0733 contributes to understanding evolutionary relationships among Clostridium species:

  • Identification of conserved structural motifs across species

  • Correlation of structural features with pathogenicity

  • Recognition of species-specific adaptations that might represent virulence determinants

  • Construction of structure-based phylogenetic trees to complement sequence-based approaches

Comparative genomic analyses have revealed substantial genetic diversity among C. botulinum group I strains . Structural studies of CLK_0733 would add another dimension to these comparisons, potentially revealing functional adaptations not apparent from sequence analysis alone.

What are the challenges in developing antibodies against CLK_0733 for research applications?

Membrane proteins like CLK_0733 present unique challenges for antibody development:

ChallengeSolution StrategyTechnical Considerations
Limited antigenicity of transmembrane regionsFocus on extramembrane loopsRequires accurate topology prediction
Conformational epitopes disrupted by detergentsUse of membrane mimetics during immunizationNanodiscs or liposomes preserve structure
Cross-reactivity with related membrane proteinsCareful epitope selection and antibody validationTest against related Clostridium species
Limited accessibility in intact cellsTarget extracellular domains for in vivo applicationsCombine with membrane permeabilization for intracellular domains

For optimal antibody development, researchers should consider using synthetic peptides representing predicted extracellular/periplasmic regions of CLK_0733, conjugated to carrier proteins. This approach has been successful for developing antibodies against other C. botulinum proteins .

What are the most pressing research questions regarding CLK_0733?

Despite increasing interest in C. botulinum membrane proteins, significant knowledge gaps remain regarding CLK_0733:

  • Determining the precise cellular function and whether it directly or indirectly influences toxin production

  • Establishing its membrane topology and identifying critical functional domains

  • Characterizing potential interactions with toxin components or other bacterial proteins

  • Understanding its conservation and variation across C. botulinum strains and serotypes

Addressing these questions requires integrating multiple experimental approaches, from structural biology and protein biochemistry to genetics and cellular microbiology.

How might systems biology approaches advance our understanding of CLK_0733?

Systems biology offers powerful frameworks for contextualizing CLK_0733 function:

  • Protein-protein interaction networks to position CLK_0733 within the cellular interactome

  • Transcriptomic analysis to identify co-regulated genes under various conditions

  • Metabolomic studies to detect metabolic changes associated with CLK_0733 manipulation

  • Comparative genomics across C. botulinum strains to assess evolutionary conservation

The successful application of multilocus genotyping to C. botulinum demonstrates the value of systematic approaches. Extending these methodologies to include functional genomics and proteomics would provide comprehensive insights into CLK_0733's biological context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.