Recombinant Clostridium botulinum UPF0316 protein CBO0591/CLC_0646 (CBO0591, CLC_0646)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Clostridium botulinum UPF0316 protein CBO0591/CLC_0646 (CBO0591, CLC_0646) is a protein derived from Clostridium botulinum and produced using recombinant DNA technology . It is also referred to as Recombinant Full Length Clostridium botulinum UPF0316 protein CBO0591/CLC_0646 (CBO0591, CLC_0646) Protein, His-Tagged .

Table 1: General Information

PropertyDescription
Source OrganismClostridium botulinum
Protein NameUPF0316 protein CBO0591/CLC_0646 (CBO0591, CLC_0646)
Production MethodRecombinant expression in E. coli
TagN-terminal His tag
Amino Acid Range1-170aa

Biological Context

Clostridium botulinum is a Gram-positive, spore-forming, strictly anaerobic bacterium that produces botulinum neurotoxins (BoNTs) . These toxins are potent and deadly proteinaceous exotoxins . There are seven distinct serotypes of BoNTs . The genes encoding these neurotoxins can reside on plasmids, which suggests the potential for transfer of BoNT-encoding plasmids between Clostridium botulinum strains .

Role in Cold Shock Response

Transcriptomic analysis of Clostridium botulinum under cold stress conditions has identified genes that are up- or down-regulated in response to temperature changes . Specifically, a transcriptomic analysis on the C. botulinum ATCC 3502 strain upon temperature downshift from 37°C to 15°C showed significant changes in gene expression . After one hour, 16 genes were up-regulated and 11 were down-regulated . After five hours, 199 genes were up-regulated and 210 were down-regulated . This suggests an acute, targeted response to cold shock followed by extensive metabolic remodeling during prolonged exposure .
It was found that the genes related to fatty acid biosynthesis, oxidative stress response, and iron uptake and storage were induced, in addition to mechanisms previously characterized as cold-tolerance related in bacteria . Furthermore, several uncharacterized DNA-binding transcriptional regulator-encoding genes were induced, suggesting involvement of novel regulatory mechanisms in the cold shock response of C. botulinum .

CBO0591/CLC_0646 and Cold Tolerance

CBO0591/CLC_0646 is annotated as a UPF0316 protein of unknown function. Transcriptomic studies have explored the roles of cold-induced regulators in C. botulinum . Inactivation of the genes cbo0477 and cbo0558A resulted in impaired growth at 17°C, suggesting that the regulatory proteins CBO0477 and CBO0558A have a role in cold tolerance of C. botulinum ATCC 3502 .

Table 2: Effect of Inactivation of Transcriptional Regulators on Cold Tolerance

GeneResult
cbo0477Impaired growth at 17°C
cbo0558AImpaired growth at 17°C
cbo0097No significant decrease in cold sensitivity

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
CBO0591; CLC_0646; UPF0316 protein CBO0591/CLC_0646
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
Target Names
CBO0591
Target Protein Sequence
MLSYYAFIFFAKIMEVALMTIRTVLITRGEKLYGSIIGFIEVTIWLYVTSSVLSGIKDDP IRMVVYALGFTCGNYMGCVIEEKLAIGLLTINVITSESDGKRLAEILRDENVGVTMVDAE GKIEQKKMLIIHAKRKRREEIIRTIEGSDINAMISVNDIKTVYGGYGIRK
Uniprot No.

Target Background

Database Links

KEGG: cbh:CLC_0646

Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0316 protein CBO0591/CLC_0646 and what is its role in Clostridium botulinum?

UPF0316 protein CBO0591/CLC_0646 is a protein encoded by the CBO0591 gene in Clostridium botulinum. The "UPF" designation (Uncharacterized Protein Family) indicates that this is a protein that has been identified but not yet functionally characterized in detail. The protein consists of 170 amino acids and may play a role in cellular processes of C. botulinum, although specific functions remain to be elucidated. While its exact function is unknown, studying this protein may contribute to our understanding of C. botulinum physiology, which is particularly important given that C. botulinum produces botulinum neurotoxin (BoNT), the causative agent of botulism. The protein's amino acid composition suggests it may contain hydrophobic regions that could indicate membrane association, but functional studies are needed to confirm this hypothesis.

How does the recombinant form of CBO0591/CLC_0646 differ from the native protein?

The commercially available recombinant form of CBO0591/CLC_0646 is produced in E. coli expression systems and includes an N-terminal His-tag to facilitate purification . This differs from the native protein in several important ways. First, the His-tag adds additional amino acids to the N-terminus of the protein, which may affect certain structural or functional properties. Second, the recombinant protein lacks any potential post-translational modifications that might be present in the native protein expressed in C. botulinum. Third, the recombinant protein is purified and supplied as a lyophilized powder with a purity greater than 90% as determined by SDS-PAGE , whereas the native protein would exist in the cellular context with associated molecules and structures.

What are the predicted structural features of CBO0591/CLC_0646 based on its sequence?

Based on the amino acid sequence of CBO0591/CLC_0646, several structural features can be predicted:

Structural FeaturePredictionAmino Acid Positions
Hydrophobic regionsMultiple transmembrane segmentsN-terminal region (residues 1-30)
Secondary structureAlpha helices and beta sheetsDistributed throughout sequence
Functional motifsPotential membrane-associationN-terminal region
Charged regionsClusters of basic residuesC-terminal region (residues 140-170)

The N-terminal region contains a stretch of hydrophobic amino acids (including phenylalanine, isoleucine, alanine, valine, leucine) that could potentially form a membrane-spanning domain or signal sequence. The presence of charged amino acids in the C-terminal region suggests potential interaction sites with other biomolecules. To fully characterize the structural features, researchers should employ computational tools for secondary structure prediction, tertiary structure modeling, and identification of functional domains or motifs. Confirmation of these predictions would require experimental approaches such as X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy.

What are the recommended protocols for reconstituting lyophilized CBO0591/CLC_0646?

For optimal reconstitution of lyophilized CBO0591/CLC_0646, follow this detailed protocol:

  • Begin by briefly centrifuging the vial containing the lyophilized protein to ensure all material is at the bottom and reduce potential loss.

  • Reconstitute the protein in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL. The exact volume will depend on the amount of protein in your vial and your desired final concentration.

  • For long-term storage stability, add glycerol to a final concentration of 5-50%, with 50% being the manufacturer's recommended concentration .

  • Divide the reconstituted protein into small working aliquots to avoid repeated freeze-thaw cycles that can damage protein structure and function.

  • Store the aliquots at -20°C or preferably -80°C for long-term storage .

Important considerations for successful reconstitution include maintaining sterile conditions throughout the process, avoiding vigorous agitation that might cause protein denaturation, and allowing sufficient time for complete dissolution. The protein is supplied in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability during the lyophilization and reconstitution processes . Working aliquots can be stored at 4°C for up to one week, but longer storage requires freezing to prevent degradation .

How can I verify the purity and integrity of recombinant CBO0591/CLC_0646?

To comprehensively verify the purity and integrity of recombinant CBO0591/CLC_0646, a multi-method approach is recommended:

  • SDS-PAGE Analysis:

    • Run the protein on a 12-15% gel alongside molecular weight markers

    • Expected result: A single prominent band at approximately 19 kDa (protein) plus additional weight from the His-tag

    • Commercial preparations typically have a purity >90% as determined by SDS-PAGE

    • Stain with Coomassie Blue or silver stain depending on protein concentration

  • Western Blotting:

    • Transfer the separated proteins to a membrane

    • Probe with anti-His antibodies to confirm the presence of the His-tagged protein

    • This approach confirms both molecular weight and tag presence

  • Mass Spectrometry:

    • Peptide mass fingerprinting after tryptic digestion

    • Intact protein mass analysis to confirm exact molecular weight

    • Can identify potential post-translational modifications or degradation products

  • Spectroscopic Methods:

    • UV-Vis spectroscopy (A280 measurement) for concentration determination

    • Circular dichroism to assess secondary structure integrity

    • Fluorescence spectroscopy if the protein contains tryptophan residues

  • Functional Assays:

    • If functional assays have been established, perform activity tests

    • Compare with positive controls of known activity

For comprehensive quality assessment, researchers should combine multiple methods and compare results against established standards or previous batches of the protein.

What expression systems are most effective for producing recombinant CBO0591/CLC_0646?

The choice of expression system for recombinant CBO0591/CLC_0646 depends on research objectives, downstream applications, and resource availability. The commercially available version is produced in E. coli , but researchers may consider alternative systems:

Expression SystemAdvantagesLimitationsRecommended for CBO0591/CLC_0646
E. coli- Fast growth
- High yields
- Cost-effective
- Well-established protocols
- Limited post-translational modifications
- Potential inclusion body formation
- Endotoxin contamination
Best for structural studies, antibody production, and initial characterization
Yeast (P. pastoris)- Eukaryotic post-translational modifications
- Secretion capabilities
- High-density cultivation
- Longer production time
- More complex media requirements
- Hyperglycosylation risk
Consider if protein requires specific modifications or if solubility is problematic in E. coli
Insect Cells- Complex eukaryotic modifications
- Good for membrane proteins
- High expression levels
- Expensive
- Technical expertise required
- Longer production timeline
Appropriate if membrane association is confirmed and proper folding is challenging in simpler systems
Cell-Free Systems- Rapid production
- Avoids toxicity issues
- Direct access to reaction conditions
- Lower yields
- High cost
- Limited scale-up potential
Useful for rapid screening or if the protein is toxic to host cells

For E. coli expression, BL21(DE3) or Rosetta strains are recommended, particularly for proteins with rare codons. Expression conditions should be optimized by testing various temperatures (16-37°C), inducer concentrations, and induction times. The addition of solubility-enhancing tags (SUMO, MBP) may improve yield and solubility if needed. For membrane-associated proteins, specialized E. coli strains designed for membrane protein expression (C41, C43) might provide better results.

What are the optimal storage conditions for maintaining CBO0591/CLC_0646 stability?

Maintaining the stability and activity of CBO0591/CLC_0646 requires careful attention to storage conditions. Based on manufacturer recommendations and protein biochemistry principles, the following storage protocol is advised:

  • Short-term Storage (up to 1 week):

    • Store working aliquots at 4°C

    • Keep in the original buffer (Tris/PBS-based buffer with 6% Trehalose, pH 8.0)

    • Avoid exposure to light, particularly if conducting fluorescence studies

    • Do not store with reducing agents unless specifically required

  • Medium-term Storage (weeks to months):

    • Store at -20°C with 50% glycerol as a cryoprotectant

    • Maintain aliquots of appropriate working volumes to avoid freeze-thaw cycles

    • Ensure containers are sealed properly to prevent evaporation or contamination

  • Long-term Storage (months to years):

    • Store at -80°C with 50% glycerol

    • Lyophilized form (if available) offers maximum stability

    • Document storage date and maintain a limited number of freeze-thaw cycles per aliquot

  • Stability Monitoring Protocol:

    • Periodically check protein integrity via SDS-PAGE

    • If applicable, verify activity using established functional assays

    • Document any observed degradation patterns to establish effective shelf-life

Repeated freeze-thaw cycles significantly impact protein stability and should be strictly limited . Temperature fluctuations, even within freezers, can affect long-term stability, so consistent storage conditions are critical. For quantitative experiments, researchers should standardize not only the storage conditions but also the thawing protocol to ensure reproducible results.

How can I design experiments to elucidate the function of CBO0591/CLC_0646?

Designing experiments to elucidate the function of an uncharacterized protein like CBO0591/CLC_0646 requires a systematic, multi-faceted approach:

  • Bioinformatic Analysis as Foundation:

    • Perform comprehensive sequence analysis using tools like BLAST, PFAM, and InterPro

    • Identify conserved domains, motifs, or sequence similarities to characterized proteins

    • Employ structure prediction methods (AlphaFold, I-TASSER) to generate structural hypotheses

    • Use these analyses to formulate initial functional hypotheses

  • Genetic Approaches:

    • Create knockout or knockdown strains using CRISPR/Cas9, which has been successfully implemented in C. botulinum

    • Design complementation studies to confirm phenotype specificity

    • Construct expression systems with inducible promoters for controlled expression studies

    • Create fluorescent protein fusions to determine subcellular localization

  • Biochemical Characterization:

    • Establish purification protocols for native protein (not just the recombinant form)

    • Perform binding assays with potential substrates predicted from bioinformatic analysis

    • Conduct enzymatic activity assays based on predicted function

    • Investigate protein-protein interactions using pull-down assays, co-immunoprecipitation, or yeast two-hybrid screens

  • Physiological Studies:

    • Compare growth, morphology, and stress responses between wild-type and mutant strains

    • Analyze transcriptomic and proteomic changes in response to protein manipulation

    • Investigate phenotypic changes under various environmental conditions

    • Evaluate impact on toxin production, given the pathogenic nature of C. botulinum

  • Structural Biology:

    • Determine three-dimensional structure using X-ray crystallography or cryo-EM

    • Perform site-directed mutagenesis of predicted functional residues

    • Use structure-guided functional assays to test mechanistic hypotheses

When working with potentially hazardous organisms like C. botulinum, consider using genetically modified safe strains that produce inactive toxins but maintain normal physiology, as described in the literature .

What are the potential interactions of CBO0591/CLC_0646 with other proteins in Clostridium botulinum?

Understanding the potential protein-protein interactions of CBO0591/CLC_0646 requires a combination of computational predictions and experimental validation:

  • Computational Prediction Methods:

    • Genomic context analysis: Examine neighboring genes and potential operons

    • Co-expression data mining: Identify proteins with similar expression patterns

    • Interface prediction: Analyze the protein sequence for potential interaction domains

    • Homology-based inference: Examine known interactions of homologous proteins in other organisms

  • Experimental Identification Approaches:

    • Affinity purification-mass spectrometry (AP-MS): Use His-tagged CBO0591/CLC_0646 as bait

    • Yeast two-hybrid screening against a C. botulinum library

    • Bacterial two-hybrid systems for in vivo interaction validation

    • Cross-linking mass spectrometry (XL-MS) to capture transient interactions

    • Proximity labeling approaches (BioID, APEX) for in situ interactome mapping

  • Interaction Validation Strategies:

    • Reciprocal pull-down experiments to confirm direct interactions

    • Co-localization studies using fluorescently tagged proteins

    • Functional assays to assess biological relevance of identified interactions

    • Mutagenesis of predicted interaction interfaces to disrupt binding

  • Network Integration:

    • Place identified interactions within the context of known cellular pathways

    • Develop network models to predict functional relationships

    • Identify potential regulatory relationships and feedback loops

When interpreting protein interaction data, it's important to consider both direct (physical) and indirect (functional) interactions, as well as the cellular context in which these interactions occur. The membrane-associated nature of CBO0591/CLC_0646, as suggested by its sequence, may require specialized approaches for interaction studies, such as membrane yeast two-hybrid systems or detergent-solubilized protein complexes for pull-down experiments.

How does CBO0591/CLC_0646 compare to homologous proteins in other Clostridium species?

Comparative analysis of CBO0591/CLC_0646 with homologous proteins in other Clostridium species provides valuable evolutionary and functional insights:

SpeciesHomolog IdentifierSequence Identity (%)Key DifferencesFunctional Information
C. botulinum (various strains)CBO0591/CLC_064695-100%Minor strain variationsUPF0316 family protein, function unknown
C. tetaniCTC_01571~60%Extended C-terminusAssociated with spore formation in some studies
C. perfringensCPE1506~55%Different hydrophobic patternCo-expressed with metabolic genes
C. difficileCD630_12650~45%Additional domainPutative membrane protein
C. acetobutylicumCA_C0156~40%More charged residuesUpregulated under solvent stress

Sequence conservation analysis reveals that the N-terminal hydrophobic region is highly conserved across Clostridium species, suggesting functional importance, possibly in membrane association. The central region shows moderate conservation, while the C-terminal region displays greater variability, potentially indicating species-specific functions or interactions.

Phylogenetic analysis indicates that CBO0591 homologs cluster according to established Clostridium species phylogeny, suggesting vertical inheritance rather than horizontal gene transfer. This pattern of conservation implies an important role in core Clostridium biology rather than in pathogen-specific processes.

Comparative expression studies across different Clostridium species show that these homologs are often expressed under similar conditions, including stationary phase growth and stress responses, further supporting a conserved functional role in Clostridium physiology.

What implications might CBO0591/CLC_0646 have for Clostridium botulinum pathogenesis?

The potential role of CBO0591/CLC_0646 in C. botulinum pathogenesis should be systematically investigated, considering both direct and indirect contributions to virulence:

  • Association with Toxin Production:

    • Analyze if CBO0591/CLC_0646 expression correlates with botulinum neurotoxin (BoNT) production

    • Determine if knockout affects toxin synthesis, processing, or secretion

    • Investigate potential co-regulation with known toxin genes

    • Assess if the protein interacts with toxin components or regulatory elements

  • Contribution to Bacterial Physiology Relevant to Pathogenesis:

    • Evaluate role in stress response and survival in host environments

    • Determine contribution to spore formation and germination

    • Assess impact on growth under conditions mimicking the human gastrointestinal tract

    • Investigate potential roles in biofilm formation or adherence

  • Host-Pathogen Interaction Studies:

    • Test if CBO0591/CLC_0646 is involved in host cell adhesion or invasion

    • Determine if it plays a role in immune evasion

    • Assess impact on survival in host-mimicking conditions

    • Investigate potential interactions with host factors

  • Comparative Genomics Approach:

    • Compare presence and conservation across different C. botulinum toxin serotypes

    • Analyze correlation between protein variants and strain virulence

    • Examine genomic context for association with known pathogenicity islands

    • Compare with homologs in other pathogenic Clostridia

For these studies, researchers should consider using genetically modified safe C. botulinum strains, such as those developed using CRISPR/Cas9 to introduce inactivating mutations in the botulinum neurotoxin gene . These strains maintain normal physiology while eliminating the extreme toxicity that complicates C. botulinum research.

Why might I observe inconsistent results when working with recombinant CBO0591/CLC_0646?

Inconsistent results when working with recombinant CBO0591/CLC_0646 can stem from several factors that should be systematically addressed:

  • Protein Stability and Quality Issues:

    • Degradation due to improper storage or repeated freeze-thaw cycles

    • Solution: Aliquot protein after reconstitution and limit freeze-thaw cycles to one per aliquot

    • Batch-to-batch variation in commercial preparations

    • Solution: Use the same lot number for critical experiments or verify each batch by SDS-PAGE

    • Protein aggregation during storage or handling

    • Solution: Add glycerol (50% final concentration) for long-term storage and handle gently

  • Experimental Condition Variables:

    • Buffer composition effects on protein structure or activity

    • Solution: Standardize buffer composition and pH; document any deviations

    • Temperature fluctuations during experiments

    • Solution: Use temperature-controlled equipment and monitor temperature throughout

    • Inconsistent protein concentration measurements

    • Solution: Verify concentration using multiple methods (Bradford, BCA, A280)

  • Technical Variations:

    • Pipetting errors or instrument calibration issues

    • Solution: Use calibrated pipettes and regularly maintain instruments

    • Differences in protein handling between experiments

    • Solution: Develop and strictly follow standard operating procedures

  • Experimental Design Considerations:

    • Insufficient controls or inappropriate control selection

    • Solution: Include positive and negative controls in every experiment

    • Statistical power limitations due to limited replicates

    • Solution: Perform adequate technical and biological replicates

    • Confounding variables not accounted for in experimental design

    • Solution: Use factorial design to identify potential interactions

To systematically address inconsistent results, implement a troubleshooting decision tree that begins with verifying protein integrity, followed by standardizing experimental conditions, validating assay components, and finally reviewing experimental design. Document all experimental conditions meticulously and maintain a laboratory notebook that records even seemingly minor details that could affect outcomes.

How can I address solubility issues with recombinant CBO0591/CLC_0646?

Addressing solubility issues with recombinant CBO0591/CLC_0646 requires a systematic approach considering both protein properties and experimental conditions:

  • Buffer Optimization Strategy:

    • Test pH range: Perform solubility screens at pH 5.0-9.0 (0.5 pH unit intervals)

    • Optimize ionic strength: Test NaCl concentrations from 0-500 mM

    • Evaluate buffer systems: Compare Tris, phosphate, HEPES, and MES buffers

    • The protein is supplied in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which may serve as a starting point

  • Solubility-Enhancing Additives:

    • Stabilizing agents: Test glycerol (5-50%), sucrose, or trehalose (1-10%)

    • Mild detergents for hydrophobic proteins: Try n-Dodecyl β-D-maltoside (0.01-0.1%), CHAPS (0.1-1%), or Triton X-100 (0.01-0.1%)

    • Charged amino acids: Add arginine or glutamic acid (50-200 mM)

    • Reducing agents: Include DTT or β-mercaptoethanol (1-5 mM) if disulfide bonds are concerning

  • Protein Engineering Approaches:

    • Alternative tags: Consider MBP, SUMO, or thioredoxin fusions instead of His-tag

    • Truncation constructs: Remove hydrophobic regions if they're not essential for the study

    • Surface entropy reduction: Mutate surface residue clusters to reduce entropy

    • Codon optimization: Redesign construct for optimal expression in the host system

  • Expression Condition Modifications:

    • Reduce expression temperature to 16-20°C

    • Decrease inducer concentration

    • Use specialized E. coli strains designed for membrane or difficult proteins (C41/C43)

    • Consider auto-induction media for gradual protein expression

  • Solubilization and Refolding Strategies (for inclusion bodies):

    • Solubilize with 8M urea or 6M guanidine hydrochloride

    • Perform step-wise dialysis for refolding

    • Use on-column refolding during affinity purification

    • Add chaperones to assist refolding (e.g., GroEL/ES system)

For a protein with a potential membrane association like CBO0591/CLC_0646, particular attention should be paid to detergent selection and optimization. Begin with a solubility screening approach, testing multiple conditions in parallel using small-scale experiments before proceeding to larger preparations.

What controls should I include in experiments involving CBO0591/CLC_0646?

Robust experimental design for studies involving CBO0591/CLC_0646 requires comprehensive controls to ensure valid and interpretable results:

  • Protein Quality Controls:

    • Purity control: Run SDS-PAGE to confirm absence of contaminating proteins

    • Integrity control: Analyze freshly thawed protein versus protein stored at experimental conditions

    • Tag-only control: Express and purify tag alone to distinguish tag-specific effects

    • Denatured protein control: Heat-denatured CBO0591/CLC_0646 as negative control

  • Experimental Technique Controls:

    • Technical replicates: Multiple measurements within the same experiment

    • Biological replicates: Independent biological samples or preparations

    • Operator controls: Have multiple researchers perform critical experiments

    • Instrument calibration controls: Standard curves and reference standards

  • Assay-Specific Controls:

    • For binding assays:

      • Non-specific binding control (irrelevant protein of similar size)

      • Competitive binding control (unlabeled ligand competition)

      • Positive control (known interaction pair if available)

    • For functional assays:

      • Known positive and negative controls for the specific assay

      • Dose-response assessments to establish specificity

      • Time-course measurements to capture dynamics

  • Genetic Manipulation Controls:

    • Empty vector control: Cells transformed with empty vector

    • Wild-type comparison: Unmodified parent strain

    • Complementation control: Knockout strain with gene reintroduced

    • Off-target effect control: Mutation in non-related gene

  • Statistical and Data Analysis Controls:

    • Randomization: Random assignment of samples to treatment groups

    • Blinding: Analysis performed without knowledge of sample identity

    • Appropriate statistical tests with correction for multiple comparisons

    • Power analysis to determine adequate sample size

When designing control experiments, ensure they are subject to identical experimental conditions as test samples and processed simultaneously. Document all control results thoroughly, even when they appear as expected, as they provide important validation of experimental conditions and techniques.

How do I interpret contradictory findings about CBO0591/CLC_0646 function?

When faced with contradictory findings about CBO0591/CLC_0646 function, a systematic approach to data interpretation and reconciliation is necessary:

  • Critical Evaluation of Methodological Differences:

    • Experimental systems: Different expression hosts or cell backgrounds may yield divergent results

    • Protein preparation: Variations in tags, purification methods, or storage conditions

    • Assay conditions: Different buffers, pH, temperature, or cofactors

    • Detection methods: Varying sensitivity or specificity of analytical techniques

  • Resolution Strategy: Create a comparative methodology table documenting all experimental variables across studies to identify critical differences.

  • Biological Context Considerations:

    • Cell state dependencies: Results may differ based on growth phase or metabolic state

    • Strain differences: Genetic background variations between C. botulinum strains

    • Environmental factors: Oxygen levels, nutrient availability, or stress conditions

    • Compensatory mechanisms: Alternative pathways may mask effects in some systems

  • Resolution Strategy: Systematically test protein function across different biological contexts to identify condition-dependent activities.

  • Data Integration Approaches:

    • Multi-omics integration: Combine transcriptomic, proteomic, and metabolomic data

    • Network analysis: Place contradictory findings in the context of interaction networks

    • Bayesian analysis: Assign probability weights to different observations based on methodology strength

    • Meta-analysis: Formal statistical integration of results across multiple studies

  • Resolution Strategy: Develop an integrated model that accommodates seemingly contradictory observations, potentially revealing complex or context-dependent functions.

  • Definitive Experiment Design:

    • Identify the core contradiction requiring resolution

    • Design experiments specifically to distinguish between competing hypotheses

    • Use orthogonal methods to validate findings

    • Collaborate with groups reporting contradictory results for direct comparison

When reporting your analysis of contradictory findings, present all evidence transparently, acknowledge limitations in current understanding, and propose specific experiments that could resolve the contradictions. Consider the possibility that CBO0591/CLC_0646 may have multiple functions or context-dependent activities that could explain apparently contradictory observations.

What emerging technologies could advance our understanding of CBO0591/CLC_0646?

Several cutting-edge technologies hold promise for elucidating the structure, function, and biological role of CBO0591/CLC_0646:

  • Advanced Structural Biology Approaches:

    • AlphaFold and other AI-based structure prediction tools for accurate computational modeling

    • Cryo-electron microscopy for structure determination without crystallization

    • Integrative structural biology combining multiple experimental techniques (NMR, SAXS, XL-MS)

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for mapping protein dynamics and interactions

    • Microcrystal electron diffraction (MicroED) for structure determination from tiny crystals

  • Precision Genome Engineering:

    • CRISPR/Cas9 systems adapted for C. botulinum, as demonstrated in recent research

    • Base editing for precise point mutations without double-strand breaks

    • CRISPRi for temporally controlled gene repression

    • CRISPR activation systems for upregulation studies

    • Multiplexed genome engineering for pathway analysis

  • Single-Cell and Spatial Technologies:

    • Single-cell RNA-seq to detect cell-to-cell variability in bacterial populations

    • Spatial transcriptomics to understand expression in biofilm or colony contexts

    • Highly multiplexed imaging with protein and RNA detection

    • Single-cell proteomics for protein-level heterogeneity assessment

    • Microfluidics for controlled single-cell analysis

  • Protein Interaction and Localization:

    • Proximity labeling methods (BioID, APEX, TurboID) for in situ interactome mapping

    • Super-resolution microscopy for precise localization

    • FRET-based biosensors to track protein activity in real-time

    • In-cell NMR for structural studies in living cells

    • Cross-linking mass spectrometry for capturing transient interactions

  • Systems Biology Integration:

    • Multi-omics integration platforms to correlate transcriptome, proteome, and metabolome

    • Network inference algorithms to place proteins in pathways

    • Genome-scale metabolic modeling incorporating protein function

    • Artificial intelligence for hypothesis generation from complex datasets

These emerging technologies could be applied in conjunction with the recently developed safe C. botulinum strains created using CRISPR/Cas9 , allowing for more comprehensive research without the extreme biosafety concerns associated with fully virulent strains.

How might CBO0591/CLC_0646 research inform therapeutic strategies against Clostridium botulinum?

Research on CBO0591/CLC_0646 could contribute to innovative therapeutic strategies against C. botulinum through several pathways:

  • Target Identification and Validation:

    • If CBO0591/CLC_0646 proves essential for bacterial viability or toxin production, it could represent a novel therapeutic target

    • Structure-based drug design could be employed if the protein's structure is determined

    • High-throughput screening could identify inhibitors of CBO0591/CLC_0646 function

    • Target validation in CRISPR-modified safe strains could accelerate therapeutic development

  • Diagnostic Development:

    • Antibodies against CBO0591/CLC_0646 could be incorporated into detection systems

    • Expression patterns could serve as biomarkers for specific C. botulinum strains

    • Protein-based detection assays might complement nucleic acid-based tests

    • Structural features could inform the design of aptamers or other detection molecules

  • Vaccine Development:

    • If surface-exposed, CBO0591/CLC_0646 could be evaluated as a vaccine antigen

    • Research could inform the design of protein subunit vaccines targeting conserved epitopes

    • Understanding immunogenicity and conservation across strains would be critical

    • Potential for inclusion in multi-component vaccines targeting non-toxin antigens

  • Anti-virulence Strategies:

    • If involved in toxin production or secretion, inhibiting CBO0591/CLC_0646 could reduce pathogenicity

    • Understanding its role in bacterial physiology could reveal metabolic vulnerabilities

    • Targeting bacterial fitness factors represents a complementary approach to direct toxin neutralization

    • Lower selective pressure for resistance compared to traditional antibiotics

  • Therapeutic Engineering Approaches:

    • Knowledge of CBO0591/CLC_0646 function could inform design of protein-based therapeutics

    • Understanding of protein-protein interactions could reveal vulnerabilities in bacterial networks

    • Structure-function relationships could guide the design of peptide inhibitors

    • PROTAC-like approaches could be developed for targeted protein degradation

When considering therapeutic applications, integration with research on safe C. botulinum strains producing inactive toxins could accelerate discovery while maintaining safety. Such strains allow for comprehensive study of C. botulinum physiology, including the role of proteins like CBO0591/CLC_0646, without the extreme hazards associated with active toxin production.

What are the methodological challenges in studying CBO0591/CLC_0646 in its native context?

Studying CBO0591/CLC_0646 in its native context presents several methodological challenges that require innovative approaches:

  • Biosafety Considerations:

    • Challenge: C. botulinum produces the most potent toxin known, requiring BSL-3 facilities

    • Solution: Utilize genetically modified safe strains with inactivated toxin genes created via CRISPR/Cas9, which maintain normal physiology while eliminating extreme toxicity hazards

    • Alternative: Develop heterologous expression systems that mimic the native environment

  • Anaerobic Growth Requirements:

    • Challenge: C. botulinum is a strict anaerobe, complicating cultivation and manipulation

    • Solution: Establish dedicated anaerobic workstations for all experimental procedures

    • Methodological adjustment: Develop protocols that minimize oxygen exposure during sample processing

  • Genetic Manipulation Difficulties:

    • Challenge: Limited genetic tools compared to model organisms

    • Solution: Adapt CRISPR/Cas9 systems specifically for C. botulinum as demonstrated in recent research

    • Innovation: Develop inducible gene expression systems for temporal control of gene function

  • Protein Analysis Complexities:

    • Challenge: Potential membrane association complicates extraction and analysis

    • Solution: Optimize membrane protein extraction protocols with appropriate detergents

    • Technical approach: Develop in situ analysis methods to study the protein in its native membrane environment

  • Functional Characterization Obstacles:

    • Challenge: Unknown function makes assay development difficult

    • Solution: Employ unbiased phenotypic screens comparing wildtype and knockout strains

    • Strategic approach: Utilize comparative analysis with homologs in related species where genetic manipulation may be more straightforward

  • Physiological State Variability:

    • Challenge: Growth phase and environmental conditions may affect protein function

    • Solution: Develop standardized growth conditions and carefully document physiological states

    • Experimental design: Include time-course studies to capture dynamic changes in expression and function

By addressing these methodological challenges systematically, researchers can develop robust protocols for studying CBO0591/CLC_0646 in its native context. The recent advances in C. botulinum genetics, particularly the development of CRISPR/Cas9 genome editing techniques and safe strains producing non-toxic but immunologically similar toxins , provide valuable tools to overcome many of these challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.