Recombinant Clostridium botulinum UPF0316 protein CLD_0163 (CLD_0163)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as per customer requirements.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
CLD_0163; UPF0316 protein CLD_0163
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Clostridium botulinum (strain Okra / Type B1)
Target Names
CLD_0163
Target Protein Sequence
MLSYYAFIFFAKIMEVALMTIRTVLITRGEKLYGSIIGFIEVTIWLYVTSSVLSGIKDDP IRMVVYALGFTCGNYMGCVIEEKLAIGLLTINVITSESDGKRLAEILRDENVGVTMVDAE GKIEQKKMLIIHAKRKRREEIIRTIEGSDINAMISVNDIKTVYGGYGIRK
Uniprot No.

Target Background

Database Links

KEGG: cbb:CLD_0163

Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological function of UPF0316 protein CLD_0163?

UPF0316 protein CLD_0163 belongs to a family of uncharacterized proteins found in Clostridium botulinum. While the exact function remains under investigation, structural analysis suggests it may play a role in membrane-associated processes based on its amino acid sequence containing hydrophobic regions. The protein contains sequences suggesting transmembrane domains, with hydrophobic regions that may facilitate membrane insertion . Researchers should note that proteins in the UPF (Uncharacterized Protein Family) designation represent knowledge gaps requiring further functional characterization through techniques such as gene knockout studies, protein-protein interaction analyses, and comparative genomics.

What are the optimal storage conditions for recombinant CLD_0163 protein?

The recombinant CLD_0163 protein requires careful storage to maintain stability and biological activity. For lyophilized preparations, storage at -20°C/-80°C provides a shelf life of approximately 12 months, while reconstituted liquid preparations generally remain stable for 6 months at the same temperatures . To prevent protein degradation from repeated freeze-thaw cycles, researchers should aliquot the protein upon reconstitution. For short-term work (up to one week), storage at 4°C is acceptable for working aliquots . The addition of glycerol to a final concentration of 50% is recommended for long-term storage to prevent freeze-thaw damage to protein structure .

How should recombinant CLD_0163 protein be reconstituted for experimental use?

Reconstitution should begin with brief centrifugation of the vial to ensure all material is at the bottom. The protein should be reconstituted in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL . For long-term storage, glycerol should be added to a final concentration of 5-50% (with 50% being the standard recommendation) before aliquoting and storing at -20°C/-80°C . This approach minimizes freeze-thaw damage and maintains protein stability. Researchers should avoid repeated freeze-thaw cycles as this significantly reduces protein activity and structural integrity.

What genetic manipulation techniques are effective for studying UPF0316 protein function in C. botulinum?

CRISPR-Cas9 "bookmark" technology represents a cutting-edge approach for studying UPF0316 protein function in C. botulinum. This methodology enables precise gene deletion followed by complementation studies to verify phenotypes . The technique involves:

  • Creating a knockout construct with homology arms flanking the target gene

  • Inserting a 24-bp "bookmark" sequence at the junction of the homology arms

  • Using CRISPR-Cas9 to facilitate replacement of the wild-type gene with the deletion construct

  • Subsequently using the bookmark as a target for Cas9 to facilitate complementation with a functional copy of the deleted gene

This approach offers advantages over older techniques like ClosTron, which could cause polar effects on downstream genes . The CRISPR-Cas9 methodology allows for markerless deletions without requiring counterselection markers, reducing the likelihood of accumulating undesired ancillary mutations during manipulation .

How can researchers distinguish between structural and functional roles of UPF0316 protein domains?

To differentiate between structural and functional domains of UPF0316 protein CLD_0163, researchers should employ a multi-faceted approach:

  • Domain Deletion Analysis: Create a series of constructs with specific domain deletions to assess which regions are essential for maintaining protein structure versus those required for function.

  • Site-Directed Mutagenesis: Target conserved amino acid residues across the protein sequence, particularly those identified in the sequence "mLSYYAFIFFAKIMEVALMTIRTVLITRGEKLYGSIIGFIEVTIWLYVTSSVLSGIKDDPIRMVVYALGFTCGNYMGCVIEEKLAIGLLTINVITSESDGKRLAEILRDENVGVTMVDAEGKIEQKKmLIIHAKRKRREEIIRTIEGSDINAMISVNDIKTVYGGYGIRK" .

  • Complementation Studies: Following gene deletion using CRISPR-Cas9, complement with various mutated versions of the protein to identify critical functional domains.

  • Structural Modeling: Employ computational techniques to predict protein structure and identify potential functional motifs, which can then be validated experimentally.

This systematic approach allows researchers to map both structural elements required for proper protein folding and domains critical for biological function.

What is the relationship between UPF0316 protein CLD_0163 and sporulation in C. botulinum?

The relationship between UPF0316 protein CLD_0163 and sporulation in C. botulinum remains an active area of investigation. While direct evidence linking CLD_0163 to sporulation is not definitively established in the available literature, researchers can investigate this relationship using the CRISPR-Cas9 system described for studying sporulation genes in C. botulinum .

To determine if CLD_0163 plays a role in sporulation:

  • Generate a CLD_0163 deletion mutant using the CRISPR-Cas9 bookmark approach

  • Culture the mutant in sporulation-promoting media such as CMM-TPGY, which was identified as effective for C. botulinum Group II strains

  • Compare sporulation efficiency between wild-type, mutant, and complemented strains through:

    • Spore counts

    • Phase-contrast microscopy

    • Molecular markers of sporulation

If CLD_0163 is involved in sporulation, researchers would expect to observe altered sporulation phenotypes in the mutant strain that can be restored through complementation.

What are the optimal expression systems for producing recombinant CLD_0163?

The recombinant CLD_0163 protein is successfully expressed in yeast systems , which offer advantages for expressing potentially toxic bacterial proteins. Researchers should consider the following methodological approaches:

Expression SystemAdvantagesLimitationsPurification Strategy
YeastPost-translational modifications, Proper protein folding, Reduced endotoxinLower yields than bacterial systems, Longer expression timeAffinity chromatography based on tag selection
E. coliHigh yields, Rapid expression, Well-established protocolsLimited post-translational modifications, Potential inclusion bodiesDenaturation-renaturation may be required for insoluble proteins
Insect cellsComplex folding, Post-translational modificationsHigher cost, Technical complexityBaculovirus expression system with affinity tags

For CLD_0163, tag selection should be optimized during the manufacturing process , with options including His-tag, GST, or MBP depending on downstream applications. The purification strategy should include optimization of buffer conditions to maintain protein stability during the process.

How can researchers validate the structural integrity of purified CLD_0163?

Validating the structural integrity of purified CLD_0163 requires multiple complementary techniques:

  • SDS-PAGE Analysis: Confirms protein purity (>85% according to product specifications) and molecular weight.

  • Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure elements (α-helices, β-sheets).

  • Dynamic Light Scattering (DLS): Assesses protein homogeneity and detects aggregation.

  • Thermal Shift Assay: Determines protein stability and identifies buffer conditions that enhance thermostability.

  • Limited Proteolysis: Probes the accessibility of protease cleavage sites to assess proper folding.

Researchers should perform these analyses immediately after purification and periodically during storage to monitor potential degradation. Additionally, comparison of freshly purified protein with stored samples allows assessment of stability under the chosen storage conditions.

What controls should be included in functional assays involving CLD_0163?

When designing functional assays for CLD_0163, researchers should include the following controls:

  • Positive Controls:

    • Well-characterized proteins from the same family if available

    • Known interacting partners if predicted

    • Positive control reactions for assay validation

  • Negative Controls:

    • Heat-denatured CLD_0163 to confirm specificity

    • Empty vector or irrelevant protein preparations to rule out contaminating activities

    • Buffer-only controls to establish baseline measurements

  • Specificity Controls:

    • Mutated versions of CLD_0163 targeting predicted functional residues

    • Competitive inhibition with peptides derived from predicted active sites

    • Dose-response experiments to establish concentration-dependent effects

  • Technical Controls:

    • Different batches of protein to ensure reproducibility

    • Multiple biological replicates

    • Independent experimental methods to confirm observations

These controls help distinguish specific functions of CLD_0163 from non-specific effects and ensure experimental robustness.

How can CLD_0163 be utilized in studying C. botulinum pathogenesis?

CLD_0163 can serve as a molecular tool for understanding C. botulinum pathogenesis through several research applications:

  • Antibody Development: Purified recombinant CLD_0163 can be used to generate specific antibodies for studying protein localization and expression patterns during infection .

  • Protein-Protein Interaction Studies: Using techniques such as pull-down assays, researchers can identify potential binding partners of CLD_0163, potentially revealing its role in virulence networks.

  • Comparative Genomics: By comparing CLD_0163 across different C. botulinum strains, researchers can identify strain-specific variations that might correlate with differences in pathogenicity.

  • Gene Manipulation Studies: The CRISPR-Cas9 "bookmark" approach described for C. botulinum can be applied to CLD_0163 to create knockout strains and assess their virulence in appropriate models .

These approaches collectively can help determine whether CLD_0163 contributes to C. botulinum pathogenesis either directly or indirectly, potentially revealing new therapeutic targets.

What techniques can be used to identify potential binding partners of CLD_0163?

Identifying binding partners of CLD_0163 requires a systematic approach using complementary techniques:

  • Affinity Purification Coupled with Mass Spectrometry (AP-MS):

    • Immobilize tagged CLD_0163 on an affinity matrix

    • Incubate with C. botulinum cell lysate

    • Wash to remove non-specific binders

    • Elute and identify co-purifying proteins by mass spectrometry

  • Yeast Two-Hybrid (Y2H) Screening:

    • Construct CLD_0163 bait plasmid

    • Screen against a C. botulinum genomic library

    • Validate positive interactions through secondary assays

  • Proximity-Dependent Biotin Identification (BioID):

    • Fuse CLD_0163 to a biotin ligase

    • Express in C. botulinum using the CRISPR-Cas9 system for genomic integration

    • Identify biotinylated proteins in proximity to CLD_0163

  • Co-Immunoprecipitation (Co-IP):

    • Generate antibodies against CLD_0163

    • Precipitate the protein from C. botulinum lysates

    • Identify co-precipitating proteins

Validation of identified interactions should include reciprocal pulldowns, co-localization studies, and functional assays to determine the biological relevance of the interactions.

How might CLD_0163 relate to sporulation and germination in C. botulinum?

The potential role of CLD_0163 in sporulation and germination processes warrants investigation considering the importance of these processes in C. botulinum survival and pathogenesis. Researchers should consider:

  • Expression Analysis: Monitor CLD_0163 expression levels during various stages of sporulation and germination using RT-qPCR and Western blotting.

  • Localization Studies: Determine the subcellular localization of CLD_0163 during sporulation using fluorescently-tagged protein constructs or immunofluorescence microscopy.

  • Mutation Studies: Generate CLD_0163 deletion mutants using the CRISPR-Cas9 bookmark technology described in the literature and evaluate their sporulation efficiency in optimized media such as CMM-TPGY .

  • Complementation Analysis: Confirm phenotypes by complementing mutants with a functional copy of CLD_0163 containing a "watermark" of silent mutations for verification .

  • Comparative Studies: Assess CLD_0163 function across different C. botulinum strains to identify strain-specific variations in sporulation mechanisms.

These approaches would help establish whether CLD_0163 plays a direct role in spore formation or germination, which would have significant implications for food safety and clinical interventions.

What computational approaches can predict CLD_0163 structure-function relationships?

Modern computational approaches offer powerful tools for predicting CLD_0163 structure and function:

  • Homology Modeling: Using the amino acid sequence provided in the literature , researchers can generate structural models based on proteins with similar sequences but known structures.

  • Ab Initio Modeling: For unique domains with no homologs, techniques like Rosetta or AlphaFold can predict structure from sequence alone.

  • Molecular Dynamics Simulations: These can provide insights into protein flexibility, domain movements, and potential conformational changes upon binding.

  • Binding Site Prediction: Algorithms can identify potential binding pockets and active sites based on structural features.

  • Evolutionary Analysis: Conservation patterns across homologs can highlight functionally important residues.

The amino acid sequence "mLSYYAFIFFAKIMEVALMTIRTVLITRGEKLYGSIIGFIEVTIWLYVTSSVLSGIKDDPIRMVVYALGFTCGNYMGCVIEEKLAIGLLTINVITSESDGKRLAEILRDENVGVTMVDAEGKIEQKKmLIIHAKRKRREEIIRTIEGSDINAMISVNDIKTVYGGYGIRK" can serve as the primary input for these computational analyses, with predictions subsequently validated by experimental approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.