Recombinant Clostridium botulinum UPF0316 protein CLI_0673 (CLI_0673)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
CLI_0673; UPF0316 protein CLI_0673
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Target Names
CLI_0673
Target Protein Sequence
MLSYYAFIFFAKIMEVALMTIRTVLITRGEKLYGSIIGFIEVTIWLYVTSSVLSGIKDDP IRMVVYALGFTCGNYMGCVIEEKLAIGLLTINVITSESDGKRLAEILRDENVGVTMVDAE GKIEQKKMLIIHAKRKRREEIIRTIEGSDINAMISVNDIKTVYGGYGIRK
Uniprot No.

Target Background

Database Links

KEGG: cbf:CLI_0673

Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Clostridium botulinum UPF0316 protein CLI_0673?

Recombinant Clostridium botulinum UPF0316 protein CLI_0673 is a protein encoded by the CLI_0673 gene in Clostridium botulinum. The protein belongs to the UPF0316 protein family, which consists of uncharacterized protein families. As a recombinant protein, it is produced using genetic engineering techniques where the gene encoding the protein is cloned and expressed in a host organism, similar to approaches used for other C. botulinum proteins .

How does CLI_0673 protein differ from other Clostridium botulinum proteins?

CLI_0673 is distinct from the well-characterized neurotoxins produced by Clostridium botulinum. While botulinum neurotoxins (BoNTs) like BoNT/A and BoNT/F are extensively studied for their role in neuromuscular paralysis and potential vaccine development, the UPF0316 protein CLI_0673 represents a different protein family with potentially different functions. Research methodologies for CLI_0673 may draw from approaches used for other C. botulinum proteins, but its unique structure and properties require specific considerations .

What expression systems are suitable for CLI_0673 production?

Based on successful expression of other C. botulinum proteins, several expression systems may be suitable for CLI_0673 production. Pichia pastoris (particularly the PichiaPink strain) has shown successful results for BoNT/A-Hc expression, while Escherichia coli has demonstrated high yields for BoNT/F-Hc expression (approximately 20 mg of purified protein per liter of culture). The selection of an appropriate expression system depends on factors including protein solubility, post-translational modification requirements, and desired yield .

What are the recommended cloning strategies for CLI_0673 expression?

For optimal CLI_0673 expression, researchers should consider the following cloning strategy based on successful approaches with similar C. botulinum proteins:

  • Gene optimization: Native C. botulinum genes contain approximately 76% A+T content with numerous codons rarely used in common expression hosts. Design a synthetic CLI_0673 gene with reduced A+T content (approximately 52%) containing synonymous codons frequently used in the target expression host .

  • Vector selection: For E. coli expression, vectors containing solubility-enhancing fusion partners (such as thioredoxin) have demonstrated success for other C. botulinum proteins. For Pichia pastoris expression, vectors like pPINK-Hc have shown promising results .

  • Affinity tag incorporation: Include a His-tag sequence if using vectors lacking this feature to facilitate subsequent purification steps .

How can I optimize soluble expression of CLI_0673 in E. coli?

To optimize soluble expression of CLI_0673 in E. coli, implement the following methodological approach:

  • Codon optimization: Design a synthetic gene with E. coli preferred codons to improve translation efficiency.

  • Fusion tags: Express CLI_0673 as a fusion protein with solubility-enhancing partners such as thioredoxin, as successfully demonstrated with BoNT/F-Hc which achieved approximately 15% of total cellular protein as soluble product .

  • Expression conditions: Optimize induction parameters including temperature (typically lowered to 16-25°C), IPTG concentration, and induction duration to favor soluble expression over inclusion body formation.

  • Host strain selection: Test expression in multiple E. coli strains optimized for recombinant protein expression, such as BL21(DE3) which has shown success with other C. botulinum proteins .

What purification strategy yields the highest purity for CLI_0673?

Based on successful purification strategies for related C. botulinum proteins, a multi-step purification approach is recommended:

  • Initial capture: Utilize nickel-nitrilotriacetic acid (Ni-NTA) affinity chromatography for His-tagged CLI_0673 proteins, which has demonstrated >95% purity for BoNT fragments in a single step .

  • Secondary purification: If necessary, implement ion exchange chromatography as a polishing step to remove remaining contaminants.

  • Buffer optimization: Dialyze purified protein overnight at 4°C against phosphate-buffered saline (PBS) to remove imidazole and prepare the protein for downstream applications .

  • Quality control: Verify protein purity using SDS-PAGE and Western blot analysis with specific antibodies if available, aiming for >95% purity as achieved with other C. botulinum recombinant proteins .

What analytical methods are recommended for CLI_0673 characterization?

A comprehensive analytical approach for CLI_0673 characterization should include:

  • SDS-PAGE and Western blotting: Confirm protein identity and purity using specific antibodies against CLI_0673 or against the affinity tag if specific antibodies are unavailable .

  • Mass spectrometry: Determine accurate molecular weight and verify protein sequence through peptide mass fingerprinting.

  • Circular dichroism (CD) spectroscopy: Assess secondary structure elements and proper protein folding.

  • Size-exclusion chromatography: Evaluate oligomeric state and homogeneity of the purified protein.

  • Functional assays: Develop specific assays based on predicted or known functions of UPF0316 family proteins.

How can I assess the structural integrity of purified CLI_0673?

To assess structural integrity of purified CLI_0673, implement the following methodological workflow:

  • Thermal shift assays: Determine protein stability through differential scanning fluorimetry to establish optimal buffer conditions and identify stabilizing ligands.

  • Limited proteolysis: Conduct controlled proteolytic digestion to identify stable domains and flexible regions, providing insights into protein folding.

  • Intrinsic fluorescence spectroscopy: Monitor changes in tryptophan/tyrosine fluorescence to assess tertiary structure integrity under various conditions.

  • Analytical ultracentrifugation: Determine sedimentation coefficient and molecular weight in solution to confirm proper folding and assembly.

How can CLI_0673 be utilized in immunological studies?

While specific immunological properties of CLI_0673 require further investigation, the following methodological approach can be implemented based on studies with other C. botulinum proteins:

  • Antibody production: Use purified CLI_0673 to generate polyclonal or monoclonal antibodies for detection and functional studies. For optimal results, immunize with purified protein using appropriate adjuvants such as Freund's or Alhydrogel as demonstrated with BoNT/F-Hc .

  • Epitope mapping: Identify immunogenic regions through peptide arrays or phage display to characterize antibody binding sites.

  • Cross-reactivity analysis: Evaluate antibody specificity against other UPF0316 family proteins to determine conservation across bacterial species.

  • Serological assays: Develop ELISA or other immunoassays using anti-CLI_0673 antibodies for detection and quantification in research samples .

What research models are appropriate for studying CLI_0673 function?

Based on research approaches for other C. botulinum proteins, consider these models:

  • In vitro binding studies: Investigate potential binding partners using pull-down assays, surface plasmon resonance, or co-immunoprecipitation to identify interacting proteins.

  • Cell culture systems: Assess cellular localization and potential effects on cell physiology using fluorescently tagged CLI_0673 in relevant cell types.

  • Mouse models: If immunological or physiological effects are identified, evaluate these in mouse models as successfully demonstrated with BoNT fragment vaccines. Begin with dose-response studies to determine appropriate concentrations (e.g., 0.04-10 μg per dose) as established for other C. botulinum proteins .

  • Bacterial genetics: Create knockout or knockdown strains in C. botulinum to assess phenotypic changes and understand physiological function.

How can I address expression challenges specific to CLI_0673?

When encountering expression challenges with CLI_0673, implement this systematic troubleshooting approach:

  • Alternate expression systems: If E. coli expression yields insoluble protein, transition to Pichia pastoris which has shown success with BoNT/A-Hc expression. Compare multiple strains (e.g., PichiaPink vs. X-33) as strain-specific differences have been observed with other C. botulinum proteins .

  • Domain expression: Identify and express functional domains of CLI_0673 rather than the full-length protein if solubility issues persist.

  • Periplasmic targeting: Direct expression to the periplasmic space using appropriate signal sequences to facilitate proper folding and disulfide bond formation.

  • Fusion partner screening: Test multiple fusion partners beyond thioredoxin, including maltose-binding protein (MBP) or glutathione S-transferase (GST), though note that GST fusions of BoNT fragments yielded lower expression levels (approximately 1 mg/L) compared to other approaches (20 mg/L) .

What strategies can resolve purification bottlenecks for CLI_0673?

When encountering purification challenges with CLI_0673, implement these advanced strategies:

  • On-column refolding: For proteins trapped in inclusion bodies, develop on-column refolding protocols during affinity purification to recover properly folded protein.

  • Split-tag approach: Utilize dual affinity tags (e.g., His-tag and Strep-tag) to enable orthogonal purification steps, dramatically increasing purity.

  • Size-exclusion chromatography: Implement as a final polishing step to separate monomeric protein from aggregates and achieve >99% purity.

  • Protease inhibitor optimization: Determine specific protease sensitivities of CLI_0673 and customize protease inhibitor cocktails accordingly to prevent degradation during purification.

How can structural biology approaches enhance CLI_0673 research?

Advanced structural biology methodologies offer significant insights into CLI_0673 function:

  • X-ray crystallography: Determine high-resolution structure by screening diverse crystallization conditions, considering both apo-protein and potential ligand complexes.

  • Cryo-electron microscopy: For challenging crystallization targets, cryo-EM may provide structural insights, particularly if CLI_0673 forms larger complexes.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Map conformational dynamics and identify regions involved in potential binding interactions.

  • Molecular dynamics simulations: Utilize experimental structures to model dynamic behavior and predict functional regions, guiding mutagenesis studies.

  • Structure-guided mutagenesis: Design point mutations based on structural data to probe functional hypotheses and identify critical residues.

How does CLI_0673 compare to botulinum neurotoxin fragments in experimental approaches?

The following comparative analysis table highlights key differences in experimental approaches between CLI_0673 and well-characterized botulinum neurotoxin fragments:

ParameterCLI_0673 (UPF0316 protein)BoNT/A-HcBoNT/F-Hc
Expression SystemLimited data, evaluation neededPichia pastoris (PichiaPink)E. coli BL21
YieldTo be determinedNot specified~20 mg/L culture
Purification MethodNi-NTA recommendedNot specifiedNi-NTA affinity
Known FunctionUncharacterizedReceptor binding domainReceptor binding domain
Molecular WeightNot specified~50 kDa~50 kDa
Therapeutic ApplicationsUnknownVaccine developmentVaccine development
Immunological ResponseTo be determinedNot specifiedStrong protective response in mice

This comparative framework provides a foundation for developing CLI_0673-specific research methodologies based on successful approaches with other botulinum proteins .

What functional predictions can be made for CLI_0673 based on other UPF0316 family proteins?

While specific functional data for CLI_0673 is limited, researchers can develop hypotheses based on characteristics of the UPF0316 protein family:

  • Comparative genomics: Analyze gene neighborhood and conservation patterns across bacterial species to identify potential functional associations.

  • Structural homology: Identify distant structural homologs through threading and fold recognition algorithms to generate functional hypotheses.

  • Expression profiling: Determine conditions under which CLI_0673 is upregulated in C. botulinum to provide functional clues.

  • Protein interaction networks: Map potential interaction partners through computational predictions and experimental validation to place CLI_0673 in biological pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.