Recombinant Clostridium botulinum UPF0316 protein CLJ_B0679 (CLJ_B0679)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to meet specific requirements.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
CLJ_B0679; UPF0316 protein CLJ_B0679
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Clostridium botulinum (strain 657 / Type Ba4)
Target Names
CLJ_B0679
Target Protein Sequence
MLSYYAFIFFAKIMEVALMTIRTVLITRGEKLYGSIIGFIEVTIWLYVTSSVLSGIKDDP IRMVVYALGFTCGNYMGCVIEEKLAIGLLTINVITSESDGKRLAEILRDKNVGVTMVDAE GKIEQKKMLIIHAKRKRREEIIRTIEGSDINAMISVNDIKTVYGGYGIRK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Clostridium botulinum UPF0316 protein CLJ_B0679?

CLJ_B0679 is a transmembrane protein of unknown function (UPF0316 family) from Clostridium botulinum strain 657/Type Ba4. It is a full-length protein consisting of 170 amino acids with UniProt accession number C3L101 . When produced recombinantly, it is typically expressed with an N-terminal 10xHis-tag to facilitate purification . As a member of the UPF0316 family, its precise biological function remains to be fully elucidated, providing an opportunity for novel research into Clostridium botulinum biology.

What expression systems are recommended for CLJ_B0679?

CLJ_B0679 has been successfully expressed in E. coli systems as indicated in product documentation . For transmembrane proteins like CLJ_B0679, consider these methodological approaches:

Expression SystemAdvantagesConsiderations
E. coli- Fast growth
- High yields
- Cost-effective
- Well-established protocols
- Potential for inclusion body formation
- Limited post-translational modifications
Pichia pastoris- Proper protein folding
- Higher-order disulfide bonds
- Post-translational modifications
- Longer expression time
- Methanol induction may be needed (as seen in BoNT protocols)
Insect cells- Superior folding for complex proteins
- Suitable for toxic proteins
- More expensive
- Longer setup time
Mammalian cells- Native-like folding and modifications
- Ideal for functional studies
- Highest cost
- Most complex setup

When selecting an expression system, consider the downstream applications. For structural studies requiring large protein quantities, E. coli remains the preferred choice if the protein is properly folded. For functional analyses, eukaryotic systems might offer advantages for proper folding and modifications .

How can I optimize CLJ_B0679 expression in E. coli?

For optimal expression of CLJ_B0679 in E. coli, consider implementing this systematic optimization approach:

  • Vector selection: Use vectors with strong but controllable promoters (T7, tac) and appropriate fusion tags. The documented N-terminal 10xHis-tag approach has proven successful .

  • Expression strain selection: For transmembrane proteins, consider specialized E. coli strains:

    • C41(DE3) or C43(DE3) - specifically evolved for membrane protein expression

    • Rosetta or CodonPlus strains - if codon optimization is needed

    • SHuffle or Origami strains - if disulfide bonds are crucial for structure

  • Culture conditions optimization:

    • Temperature: Lower temperatures (16-25°C) often improve folding

    • Induction: Test various IPTG concentrations (0.1-1 mM)

    • Media: Compare rich media (LB, TB) versus minimal media

    • Growth phase: Induce at different OD600 values (0.6-1.0)

  • Solubility assessment: Monitor expression via small-scale tests comparing soluble and insoluble fractions through SDS-PAGE and Western blotting using anti-His antibodies.

Remember that transmembrane proteins often require detergents for extraction from membranes. Consider testing mild detergents (DDM, LDAO, OG) during lysis and purification steps.

What are the optimal storage conditions for purified CLJ_B0679?

Based on manufacturer recommendations, CLJ_B0679 should be stored at -20°C, with extended storage at -20°C or -80°C . To preserve protein stability:

  • Buffer considerations:

    • Standard buffer: 50 mM phosphate or HEPES, pH 7.4, with 150 mM NaCl

    • For membrane proteins: Include appropriate detergent at concentrations above CMC

    • Stabilizing additives: 5-10% glycerol, 1 mM DTT or TCEP (if needed for redox stability)

  • Aliquoting strategy: Divide purified protein into single-use aliquots to avoid repeated freeze-thaw cycles, which are particularly detrimental to membrane proteins .

  • Storage duration:

    • Liquid form: Up to 6 months at -20°C/-80°C

    • Lyophilized form: Up to 12 months at -20°C/-80°C

  • Working aliquots: For ongoing experiments, store working aliquots at 4°C for no more than one week, as recommended in the product documentation .

How can I assess CLJ_B0679 activity after storage?

  • Structural integrity assessment:

    • SDS-PAGE for degradation analysis

    • Size exclusion chromatography to detect aggregation

    • Circular dichroism to verify secondary structure maintenance

  • Binding assays: If working with the His-tagged version, verify tag accessibility through small-scale IMAC binding.

  • Membrane integration assessment: For transmembrane proteins like CLJ_B0679, validate membrane association through:

    • Detergent partitioning experiments

    • Liposome reconstitution followed by flotation assays

    • Limited proteolysis to probe accessible regions

  • Thermal stability assessment: Techniques like differential scanning fluorimetry (DSF) can provide insights into protein stability before and after storage.

What approaches can determine the function of uncharacterized proteins like CLJ_B0679?

As a UPF0316 family protein with unknown function, elucidating CLJ_B0679's role requires multiple complementary approaches:

  • Computational analysis:

    • Sequence homology searches across databases

    • Structural prediction and comparison with functionally characterized proteins

    • Genomic context analysis: examine neighboring genes in the C. botulinum genome

  • Localization studies:

    • Generate fluorescently tagged versions to determine subcellular localization

    • Membrane fractionation followed by Western blotting

    • Immunogold electron microscopy with antibodies against CLJ_B0679

  • Interaction studies:

    • Pull-down assays using His-tagged CLJ_B0679 to identify binding partners

    • Bacterial two-hybrid screening

    • Crosslinking followed by mass spectrometry

    • Co-immunoprecipitation studies similar to those used for TSHR-CD40 interactions

  • Genetic approaches:

    • Gene knockout or knockdown phenotype analysis

    • Complementation studies

    • Conditional expression systems

  • Structural biology:

    • X-ray crystallography or cryo-EM for detailed structural information

    • NMR for dynamic studies

How does CLJ_B0679 compare to other botulinum neurotoxin-associated proteins?

While CLJ_B0679 is not directly identified as a neurotoxin component, understanding its relation to botulinum neurotoxins (BoNTs) provides research context:

  • Genomic context comparison:

    • BoNTs are typically encoded in gene clusters that include accessory proteins

    • Determine if CLJ_B0679 is encoded near BoNT genes or associated regulatory elements

  • Expression correlation:

    • Compare expression patterns of CLJ_B0679 with known BoNT components using RT-PCR or RNA-seq

    • Determine if CLJ_B0679 is co-regulated with toxin production

  • Functional comparison with neurotoxin components:

    • Unlike the light chain of BoNT/A which has metalloprotease activity that can be measured through FITC/DABCYL-based fluorescence assays , CLJ_B0679's function is unknown

    • Test whether CLJ_B0679 affects BoNT production, stability, or activity in expression systems

  • Structural comparison:

    • Compare predicted structural features with those of known BoNT accessory proteins

    • Look for common motifs or domains shared with characterized neurotoxin components

Why might I observe degradation of CLJ_B0679 during expression or purification?

Degradation of transmembrane proteins like CLJ_B0679 is a common challenge. Consider these methodological solutions:

  • Protease inhibition strategies:

    • Add protease inhibitor cocktails (e.g., PMSF, EDTA) to lysis buffer as used in related protocols

    • Consider using E. coli strains deficient in certain proteases (BL21, Rosetta)

    • Maintain low temperatures (4°C) during all purification steps

  • Expression optimization:

    • Reduce induction time or inducer concentration

    • Lower expression temperature (16-20°C)

    • Test different growth phases for induction

  • Purification troubleshooting:

    • Implement faster purification protocols to minimize exposure time

    • Add stabilizing agents (glycerol, reducing agents) to buffers

    • Consider detergent screening to find optimal membrane protein extraction conditions

  • Analysis of degradation patterns:

    • Western blotting with antibodies against N-terminal and C-terminal regions to identify degradation sites

    • Mass spectrometry analysis of degradation products to identify vulnerable regions

How can I validate the structural integrity of purified CLJ_B0679?

For transmembrane proteins like CLJ_B0679, structural validation is crucial but challenging. Implement these complementary approaches:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Fluorescence spectroscopy to evaluate tertiary structure (if tryptophan residues are present)

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine oligomeric state

  • Limited proteolysis:

    • Compare digestion patterns of properly folded versus denatured protein

    • Well-folded transmembrane proteins often show resistance to proteolysis in their membrane-spanning regions

  • Thermal stability assays:

    • Differential scanning fluorimetry (DSF) or thermal shift assays

    • Compare stability profiles in different buffer conditions

  • Functional validation (if applicable):

    • Verify membrane integration through liposome reconstitution

    • Test for specific binding to potential interaction partners

    • Compare properties with similar UPF0316 family proteins where some functional data exists

What controls should I include when studying CLJ_B0679?

Robust experimental design requires appropriate controls for CLJ_B0679 research:

  • Expression controls:

    • Empty vector control to establish baseline expression patterns

    • Well-characterized membrane protein control (e.g., bacteriorhodopsin) to validate membrane protein methods

    • Non-transmembrane protein control with similar size (e.g., GFP with His-tag) to distinguish membrane-specific issues

  • Purification controls:

    • Pre- and post-induction samples to confirm expression

    • Flow-through and wash fractions to monitor purification efficiency

    • Negative control purifications from non-expressing cells

  • Stability and activity controls:

    • Fresh versus stored protein comparisons to evaluate storage effects

    • Denatured protein control for structural studies

    • Related UPF0316 family proteins from other bacterial species for comparative analysis

  • Interaction study controls:

    • Tag-only controls for pull-down experiments

    • Unrelated transmembrane protein controls for specificity assessment

    • Competitive binding controls to validate specific interactions

How does CLJ_B0679 compare to UPF0316 proteins in other bacterial species?

The UPF0316 protein family extends beyond Clostridium botulinum, offering comparative insights:

  • Sequence conservation analysis:

    • Perform multiple sequence alignments of UPF0316 proteins across bacterial species

    • Identify conserved motifs that may indicate functional regions

    • Analyze evolutionary relationships through phylogenetic trees

FeatureCLJ_B0679UPF0316 Family AverageSignificance
Length170 aa150-190 aaWithin typical range
Transmembrane domainsPredicted membrane protein 3-5 TM domains typicallyConsistent with family
Conserved motifsTo be determinedGXXXG, PXXP commonPotential functional sites
Genomic contextTo be analyzedOften near metabolic genesMay indicate functional association
  • Structural comparison:

    • Compare predicted secondary structure elements

    • Identify conservation of key amino acids in transmembrane regions

    • Look for shared structural motifs that might indicate similar functions

  • Functional inference:

    • Examine characterized UPF0316 family members in other organisms

    • Transfer functional hypotheses if strong homology exists

    • Design experiments to test these functional predictions

What are potential research directions for understanding CLJ_B0679's role in C. botulinum biology?

Given CLJ_B0679's classification as a transmembrane protein of unknown function in a highly pathogenic bacterium, several research avenues deserve exploration:

  • Virulence association studies:

    • Compare expression under conditions that induce toxin production

    • Determine if CLJ_B0679 deletion affects toxin levels or activity

    • Test if CLJ_B0679 influences bacterial survival under stress conditions

  • Membrane biology investigations:

    • Characterize membrane localization patterns

    • Determine if CLJ_B0679 functions in membrane integrity, transport, or signaling

    • Investigate potential roles in bacterial secretion systems

  • Structural biology approaches:

    • Solve CLJ_B0679 structure using crystallography, NMR, or cryo-EM

    • Compare with structural homologs to infer function

    • Identify potential binding pockets or functional sites

  • Development of research tools:

    • Generate specific antibodies against CLJ_B0679

    • Develop activity assays based on hypothesized functions

    • Create tagged variants for localization and interaction studies

  • Comparative genomics across C. botulinum strains:

    • Analyze conservation and variation of CLJ_B0679 across strains with different virulence profiles

    • Determine if sequence variations correlate with specific phenotypes

    • Identify strain-specific features that might influence function

By systematically addressing these research directions, investigators can contribute to understanding the functional role of CLJ_B0679 in Clostridium botulinum biology and potentially identify new targets for therapeutic intervention.

What special considerations apply when working with proteins from Clostridium botulinum?

Working with proteins from C. botulinum requires attention to both safety and technical aspects:

  • Biosafety considerations:

    • While CLJ_B0679 itself is not identified as a toxin component, it originates from a highly pathogenic organism

    • Follow institutional biosafety guidelines for working with C. botulinum-derived materials

    • Use recombinant expression in safe host organisms (E. coli) rather than native purification

  • Technical challenges:

    • Codon usage: C. botulinum has different codon preferences than E. coli, potentially requiring codon optimization or specialized expression strains

    • Protein toxicity: Some C. botulinum proteins may be toxic to expression hosts, necessitating tightly controlled expression systems

    • Authentication: Verify recombinant protein identity through mass spectrometry or N-terminal sequencing

  • Experimental design:

    • Include appropriate negative controls from non-pathogenic species

    • Consider designing truncated versions if the full-length protein is difficult to express

    • Validate function in multiple systems to ensure reproducibility

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.