Recombinant Clostridium botulinum UPF0316 protein CLK_3798 (CLK_3798)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is assigned during production. To request a specific tag, please specify it in your order; we will prioritize fulfilling such requests.
Synonyms
CLK_3798; UPF0316 protein CLK_3798
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Clostridium botulinum (strain Loch Maree / Type A3)
Target Names
CLK_3798
Target Protein Sequence
MLSYYAFIFFAKIMEVALMTIRTVLITRGEKLYGSIIGFIEVTIWLYVTSSVLSGIKDDP IRMVVYALGFTCGNYMGCVIEEKLAIGLLTINVITSESDGKRLAEILRDENVGVTMVDAE GKIEQKKMLIIHAKRKRREEIIRTIEGSDINAMISVNDIKTVYGGYGIRK
Uniprot No.

Target Background

Database Links

KEGG: cbl:CLK_3798

Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does CLK_3798 differ structurally and functionally from botulinum neurotoxins?

CLK_3798 differs significantly from the well-characterized botulinum neurotoxins (BoNTs) in several key aspects:

FeatureCLK_3798 (UPF0316)Botulinum Neurotoxins (BoNTs)
SizeSmaller (~19.8 kDa)Larger (~150 kDa)
Domain StructureSingle domain predictedThree distinct domains (LC, HCN, HCC)
FunctionUnknown, likely non-toxicNeurotoxic (cleaves SNARE proteins)
Target InteractionNo known neural receptorsBinds SV2 proteins and gangliosides
Complex FormationNot part of toxin complexesForms complexes with NAPs (NTNH, HA70, HA17)

Unlike BoNTs, which are zinc-dependent proteases that cleave proteins involved in neurotransmitter release (SNAP-25, syntaxin), CLK_3798 has no known enzymatic activity related to neurotoxicity. While BoNTs are extensively studied for their medical applications, the functional significance of UPF0316 proteins remains largely uncharacterized .

What is the current state of knowledge regarding UPF0316 protein function?

Research on UPF0316 proteins, including CLK_3798, is still in its early stages. Current evidence suggests:

  • Conservation across multiple Clostridium species indicates functional importance

  • Not directly involved in the neurotoxicity mechanism of C. botulinum

  • May play roles in basic cellular processes rather than virulence

  • Specific biochemical function remains uncharacterized

  • Not part of the toxin gene cluster (ha-orfX+ or ntnh-ha) in the C. botulinum genome

Computational analyses predict potential membrane association based on hydrophobic regions, but experimental validation is lacking. The consistent preservation of this protein across different strains suggests an important role in bacterial physiology, potentially in stress response or environmental adaptation .

What are the optimal storage conditions for recombinant CLK_3798?

For maximum stability and activity retention of recombinant CLK_3798, the following storage conditions are recommended:

  • Short-term storage (up to one week): Store working aliquots at 4°C

  • Long-term storage: Store at -20°C/-80°C in single-use aliquots

  • Storage buffer: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Lyophilized form: Store at -20°C with desiccant (stable for up to 12 months)

  • Reconstituted protein: Add glycerol to 50% final concentration before freezing

Repeated freeze-thaw cycles significantly reduce protein stability and should be avoided. The expected shelf life is approximately 6 months for liquid preparations at -20°C/-80°C and up to 12 months for lyophilized preparations .

What protocol is recommended for reconstitution of lyophilized CLK_3798?

For optimal reconstitution of lyophilized CLK_3798:

  • Briefly centrifuge the vial to bring contents to the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL concentration

  • Mix gently until completely dissolved (avoid vigorous shaking)

  • For long-term storage, add glycerol to 50% final concentration

  • Aliquot into single-use volumes

  • Store as described in the storage protocol

Reconstituted protein should be used immediately for maximum activity or properly stored according to recommendations. The quality of reconstituted protein can be assessed by SDS-PAGE to confirm integrity .

What are the key considerations for designing expression vectors for CLK_3798?

When designing expression vectors for CLK_3798, researchers should consider:

  • Codon optimization: Adjust codons for E. coli expression to avoid rare codons present in Clostridium genes

  • Promoter selection: T7 promoter systems provide high-level expression in BL21(DE3) strains

  • Tag placement: N-terminal His-tag provides efficient purification while minimizing interference with potential C-terminal functional elements

  • Protease cleavage sites: Include TEV or thrombin sites for tag removal if tag-free protein is needed

  • Vector backbone: pET series vectors provide tight regulation and high expression

  • Selection marker: Ampicillin or kanamycin resistance genes are commonly used

  • Solubility enhancement: Consider fusion partners (SUMO, MBP, GST) if solubility issues are encountered

Researchers should validate constructs by sequencing and pilot expression tests before scaling up production .

What analytical techniques are most effective for characterizing the tertiary structure of CLK_3798?

A multi-technique approach is recommended for comprehensive structural characterization of CLK_3798:

How can mass spectrometry be used to identify post-translational modifications in CLK_3798?

Mass spectrometry offers several approaches for comprehensive PTM analysis of CLK_3798:

  • Bottom-up Proteomics Approach:

    • Enzymatic digestion (trypsin, chymotrypsin, Glu-C) for comprehensive coverage

    • LC-MS/MS analysis of peptides

    • Database searching with variable modification parameters

    • Multiple fragmentation methods (CID, HCD, ETD) for improved PTM characterization

    • Site localization algorithms to precisely identify modified residues

  • Targeted PTM Enrichment:

    • Phosphorylation: IMAC, titanium dioxide chromatography

    • Glycosylation: Hydrazide chemistry, lectin affinity

    • Acetylation: Anti-acetyllysine antibodies

    • Methods should be selected based on predicted modifications

  • Top-down Proteomics:

    • Analysis of intact protein to preserve PTM combinations

    • High-resolution instruments (Orbitrap, FTICR) for accurate mass determination

    • ETD or ECD fragmentation for improved sequence coverage while maintaining PTMs

    • Deconvolution algorithms for complex spectra interpretation

  • Data Analysis Strategy:

    • Use open search parameters to detect unexpected modifications

    • Apply false discovery rate control for modification assignments

    • Quantify modified peptides relative to unmodified counterparts

    • Validate critical PTMs by site-directed mutagenesis

Recent proteomic studies of C. botulinum proteins have achieved >90% sequence coverage using these approaches, making comprehensive PTM mapping feasible .

What approaches can identify potential binding partners of CLK_3798?

Multiple complementary approaches can be employed to identify binding partners:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Use His-tagged CLK_3798 as bait on Ni-NTA resin

    • Incubate with C. botulinum lysate or recombinant candidate proteins

    • Wash extensively to remove non-specific binders

    • Elute and identify bound proteins by MS/MS

    • Implement quantitative approaches (SILAC, TMT) to distinguish specific interactions

    • Include appropriate controls (tag-only, unrelated proteins)

  • Protein Microarrays:

    • Array potential binding partners on slides

    • Probe with fluorescently labeled CLK_3798

    • Detect binding through fluorescence scanning

    • Analyze results using specialized software to identify positive interactions

  • Surface Plasmon Resonance (SPR):

    • Immobilize CLK_3798 on a sensor chip

    • Flow potential binding partners over the surface

    • Measure binding kinetics and affinity constants

    • Validate significant interactions with reciprocal experiments

  • Crosslinking-MS Approaches:

    • Treat protein complexes with crosslinking reagents

    • Digest and analyze by MS/MS

    • Identify crosslinked peptides to map interaction interfaces

    • Use specialized search algorithms for crosslinked peptide identification

  • Co-immunoprecipitation with Antibody Validation:

    • Generate specific antibodies against CLK_3798

    • Perform immunoprecipitation from bacterial lysates

    • Identify co-precipitated proteins by MS

    • Validate with reciprocal immunoprecipitation

How does CLK_3798 sequence conservation compare across different strains of C. botulinum?

Analysis of CLK_3798 sequences across multiple C. botulinum strains reveals important patterns:

  • High Core Conservation:

    • Central regions (residues 50-140) show >90% sequence identity across strains

    • The GFTCGNYMGCV motif (residues 80-90) is nearly 100% conserved

    • Conservation suggests functional importance of these regions

  • Variable Termini:

    • N-terminal region (residues 1-30) shows higher variability (70-85% identity)

    • C-terminal region (residues 150-170) displays strain-specific insertions/deletions

    • These variations may reflect adaptation to different ecological niches

  • Strain Clustering:

    • Sequence variations cluster according to established C. botulinum groups

    • Group I (proteolytic) strains show distinct sequence patterns from Group II (nonproteolytic)

    • Certain amino acid substitutions correlate with optimal growth temperature

  • Evolutionary Implications:

    • The conservation pattern suggests purifying selection on functional domains

    • Terminal regions may be under different selective pressures

    • Certain positions display signatures of positive selection

This pattern of conservation provides insights into functionally important regions and may help identify critical residues for future mutagenesis studies .

How do UPF0316 proteins like CLK_3798 relate to their homologs in other bacterial species?

UPF0316 proteins show interesting evolutionary relationships across bacterial species:

  • Taxonomic Distribution:

    • Present primarily in Gram-positive bacteria, particularly Firmicutes

    • Highest sequence similarity (60-80%) with homologs in other Clostridium species

    • Moderate similarity (40-60%) with proteins in Bacillus and Listeria

    • Lower but significant similarity (30-40%) with proteins in other anaerobes

  • Structural Conservation:

    • Core structural elements predicted to be conserved across diverse species

    • N-terminal hydrophobic regions show higher variability but maintain hydrophobic character

    • Specific motifs (e.g., GFTCGNYMGC) serve as signature sequences for this protein family

  • Genomic Context:

    • UPF0316 genes often found in conserved operons across related species

    • Frequently co-localized with genes involved in stress response or membrane functions

    • Genomic neighborhood provides clues to potential functional associations

  • Evolutionary Origin:

    • Phylogenetic analysis suggests ancient origin predating diversification of clostridia

    • Evidence of horizontal gene transfer in some lineages

    • Conservation across diverse species indicates fundamental cellular role

Comprehensive comparative analysis of UPF0316 proteins can provide insights into the evolution of C. botulinum and related species, as well as potential functional implications of CLK_3798 .

How can sequence analysis be used to predict functional domains in CLK_3798?

Sophisticated sequence analysis methods can identify potential functional domains:

  • Profile-based Methods:

    • PSI-BLAST searches against non-redundant databases

    • Hidden Markov Model (HMM) analysis using Pfam and SUPERFAMILY

    • Position-Specific Scoring Matrix (PSSM) construction from multiple alignments

    • These methods identify distant homology relationships not detected by basic BLAST

  • Pattern and Motif Analysis:

    • MEME/MAST for de novo motif discovery

    • PROSITE scanning for known functional motifs

    • Conservation analysis to identify functionally constrained regions

    • Correlation analysis to identify co-evolving residues that may function together

  • Secondary Structure Prediction:

    • JPred, PSIPRED for α-helix and β-strand prediction

    • TMHMM, HMMTOP for transmembrane region prediction

    • SignalP for signal peptide detection

    • These tools help delineate structural domains and potential membrane associations

  • Disorder Prediction:

    • IUPred, PONDR for intrinsically disordered region identification

    • ANCHOR for prediction of disordered binding regions

    • Identification of potential flexible linkers between functional domains

  • Functional Site Prediction:

    • ConSurf for identification of evolutionarily conserved residues

    • 3DLigandSite for ligand binding site prediction

    • FEATURE for functional element identification

    • MetalDetector for metal-binding site prediction

These computational approaches provide testable hypotheses for experimental validation, guiding the design of targeted mutagenesis experiments to probe protein function .

How can CLK_3798 be utilized in developing novel diagnostic tools for C. botulinum?

CLK_3798 offers several advantages for developing advanced C. botulinum diagnostics:

  • Nucleic Acid-Based Detection:

    • Design specific PCR primers targeting the CLK_3798 gene

    • Develop real-time PCR assays for quantitative detection

    • Create LAMP (Loop-mediated isothermal amplification) assays for field diagnostics

    • Multiplex with toxin gene detection for comprehensive strain typing

  • Protein-Based Detection Systems:

    • Generate specific monoclonal antibodies against CLK_3798

    • Develop sandwich ELISA systems using anti-CLK_3798 antibodies

    • Create lateral flow immunoassays for rapid point-of-care testing

    • Implement antibody arrays for multiplex detection

  • Biosensor Development:

    • Immobilize anti-CLK_3798 antibodies on transducer surfaces

    • Develop aptamer-based detection systems specific for CLK_3798

    • Create SPR or QCM-based biosensors for label-free detection

    • Implement in portable formats for field testing

  • Advantages Over Current Methods:

    • Potential marker for detecting non-toxigenic C. botulinum strains

    • Complementary to toxin-based detection systems

    • Conservation across strains may enable broad-spectrum detection

    • Sequence variations could allow strain-specific identification

  • Validation Strategy:

    • Test against diverse panel of C. botulinum strains

    • Assess cross-reactivity with closely related species

    • Determine limit of detection in various matrices (food, clinical, environmental)

    • Compare performance with established detection methods

What cell-free expression systems are most suitable for producing CLK_3798 for structural studies?

Cell-free protein synthesis (CFPS) systems offer advantages for structural studies of CLK_3798:

  • E. coli-based CFPS Systems:

    • Commercial kits available (e.g., PURExpress, CECF)

    • High yield (100-1000 μg/mL) with optimized protocols

    • Compatible with isotopic labeling for NMR studies

    • Implementation protocol:

      • Prepare plasmid with T7 promoter and appropriate tags

      • Set up reaction with extract, energy solution, amino acids, and template

      • Incubate at 30°C for 2-6 hours

      • Purify using affinity chromatography

  • Wheat Germ Extract Systems:

    • Lower yield but often better for folding complex proteins

    • Suitable for proteins toxic to E. coli

    • Reduced proteolytic activity increases protein stability

    • Implementation approach:

      • Use species-optimized codon usage

      • Include stabilizing additives (PEG, chaperones)

      • Extend reaction time (12-24 hours) at lower temperature

  • Insect Cell-Free Systems:

    • Intermediate between prokaryotic and mammalian systems

    • Support many eukaryotic post-translational modifications

    • Good compromise between yield and folding quality

    • Technical approach:

      • Use baculovirus-derived regulatory elements

      • Include microsomes for membrane protein production

      • Supplement with disulfide-forming components

  • Optimization Strategies:

    • Screen multiple N- and C-terminal tags for solubility

    • Test various redox conditions for optimal disulfide formation

    • Adjust magnesium and potassium concentrations for maximum yield

    • Include molecular chaperones to improve folding

  • Advantages for Structural Studies:

    • Rapid production of protein samples

    • Direct incorporation of unnatural amino acids for biophysical studies

    • Efficient isotopic labeling for NMR studies

    • Production of toxic proteins not amenable to cellular expression

Cell-free systems provide efficient production of CLK_3798 for various structural biology applications, including NMR, X-ray crystallography, and cryo-EM studies .

How can CLK_3798 be studied in the context of C. botulinum physiology and pathogenesis?

Comprehensive approaches to study CLK_3798 in C. botulinum biology include:

  • Genetic Manipulation Strategies:

    • Gene knockout/knockdown using CRISPR-Cas9 or antisense RNA

    • Conditional expression systems to control protein levels

    • Reporter fusion constructs to track expression and localization

    • Complementation with mutant variants to assess functional domains

    • Technical challenges: Anaerobic culture requirements, transformation efficiency

  • Transcriptomic Analysis:

    • RNA-Seq to monitor expression patterns under various conditions

    • Compare expression with known virulence factors

    • Identify co-regulated genes for functional network analysis

    • Analyze expression during different growth phases and stress conditions

    • Methodological approach: RNA extraction from anaerobic cultures, library preparation, deep sequencing

  • Proteomics Integration:

    • Quantitative proteomics to measure protein abundance

    • Protein interaction network analysis

    • Post-translational modification profiling

    • Secretome analysis to determine if CLK_3798 is secreted

    • Techniques: SILAC, TMT labeling, affinity purification-MS

  • Phenotypic Characterization:

    • Growth analysis of mutant strains under various conditions

    • Stress response testing (oxidative, temperature, pH)

    • Toxin production measurement in mutant strains

    • Spore formation and germination assessment

    • Methods: Batch cultivation, stress exposure assays, toxin ELISA

  • Host-Pathogen Interaction Studies:

    • Cell culture infection models to assess adherence/invasion

    • Mouse botulism models if relevant

    • Immune response analysis

    • Impact on toxin delivery or activity

    • Approaches: Tissue culture infection, in vivo models, immunological assays

These integrated approaches can reveal the role of CLK_3798 in C. botulinum biology, potentially identifying new therapeutic targets or diagnostic markers .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.