Recombinant Clostridium botulinum UPF0316 protein CLM_0701 (CLM_0701)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
CLM_0701; UPF0316 protein CLM_0701
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Clostridium botulinum (strain Kyoto / Type A2)
Target Names
CLM_0701
Target Protein Sequence
MLSYYAFIFFAKIMEVALMTIRTVLITRGEKLYGSIIGFIEVTIWLYVTSSVLSGIKDDP IRMVVYALGFTCGNYMGCVIEEKLAIGLLTINVITSESDGKRLAEILRDENVGVTMVDAE GKIEQKKMLIIHAKRKRREEIIRTIEGSDINAMISVNDIKTVYGGYGIRK
Uniprot No.

Target Background

Database Links

KEGG: cby:CLM_0701

Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0316 protein CLM_0701 and what organism does it originate from?

UPF0316 protein CLM_0701 is an uncharacterized conserved protein from Clostridium botulinum, specifically strain Kyoto/Type A2. It belongs to the UPF0316/DUF2179 protein family, a group of proteins with unknown function that are conserved across various bacterial species . The protein has been assigned the UniProt accession number C1FT66, indicating its registration in the Universal Protein Resource database, which provides comprehensive information on protein sequences and functional annotations . As an uncharacterized protein, CLM_0701 represents an opportunity for novel research into potential functions within the bacterial proteome, particularly in relation to Clostridium botulinum biology.

How is CLM_0701 classified in protein databases and what does this classification indicate?

CLM_0701 is classified under the Clusters of Orthologous Groups (COG) system as COG4843, specifically in the "S" functional category which indicates "Function Unknown" . It belongs to the UPF0316/DUF2179 family, where UPF stands for "Uncharacterized Protein Family" and DUF refers to "Domain of Unknown Function" . The protein is referenced in multiple databases including UniProt (accession C1FT66) and ChemicalBook (CB615629485) . This classification suggests that while the protein's structural characteristics may be partially defined, its biological function remains undetermined. The conservation of this protein across 251 organisms (as indicated by COG data) suggests it may play an important biological role despite its currently uncharacterized status .

What are the general physical and biochemical properties of recombinant CLM_0701?

The recombinant Clostridium botulinum UPF0316 protein CLM_0701 is available as a partial protein with a purity greater than 85% as determined by SDS-PAGE analysis . While specific molecular weight data is not provided in the available information, proteins in the UPF0316 family typically have a median protein length of approximately 185.69 amino acids based on COG4843 statistics . The protein is available in both liquid and lyophilized forms, with different stability characteristics for each formulation . The recombinant protein has been produced using two different expression systems: E. coli (product code CSB-EP500345DUH1-B) and Baculovirus (product code CSB-BP500345DUH1), which may result in different post-translational modifications and functional characteristics .

What are the optimal storage conditions for maintaining CLM_0701 stability and activity?

The optimal storage conditions for CLM_0701 depend on the formulation and intended usage timeframe. For long-term storage, both liquid and lyophilized forms should be kept at -20°C to -80°C, with the liquid form having a shelf life of approximately 6 months and the lyophilized form remaining stable for up to 12 months under these conditions . For working aliquots that will be used within one week, storage at 4°C is recommended . It is crucial to avoid repeated freeze-thaw cycles as these can significantly compromise protein integrity and biological activity . This degradation occurs due to structural changes during the freeze-thaw process, including potential denaturation, aggregation, or loss of tertiary structure that may affect functional studies.

How should CLM_0701 be reconstituted for optimal experimental use?

For optimal reconstitution of CLM_0701, the following methodological approach is recommended:

  • Before opening, briefly centrifuge the vial to bring all contents to the bottom and minimize protein loss

  • Reconstitute the protein in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the manufacturer's default recommendation)

  • Prepare multiple aliquots to avoid repeated freeze-thaw cycles

  • Store reconstituted aliquots at -20°C to -80°C for long-term storage

This reconstitution protocol helps maintain protein stability by preventing aggregation and denaturation. The addition of glycerol acts as a cryoprotectant, reducing ice crystal formation during freezing that could damage protein structure .

What expression systems are available for CLM_0701 production and how do they differ?

Two main expression systems are documented for the production of recombinant CLM_0701:

Expression SystemProduct CodeAdvantagesPotential Limitations
E. coliCSB-EP500345DUH1-BHigh yield, cost-effective, rapid productionMay lack post-translational modifications, potential endotoxin contamination
BaculovirusCSB-BP500345DUH1More complex post-translational modifications, eukaryotic processingLower yield, more expensive, longer production time

The choice between these systems depends on the specific research requirements. The E. coli-derived protein may be suitable for structural studies and applications where post-translational modifications are not critical . In contrast, the Baculovirus-expressed protein might be preferable for functional studies where eukaryotic-like post-translational modifications could impact activity or for applications where lower endotoxin levels are required .

What approaches can be used to investigate the unknown function of CLM_0701?

Investigating the unknown function of CLM_0701 requires a multidisciplinary approach combining computational, structural, and experimental methodologies:

  • Computational Analysis:

    • Sequence homology searches against characterized proteins

    • Structural prediction using AlphaFold or similar tools

    • Analysis of genomic context to identify potential operons

    • Phylogenetic profiling to identify co-evolving proteins

  • Structural Biology:

    • X-ray crystallography or cryo-EM to determine 3D structure

    • NMR spectroscopy for protein dynamics studies

    • Molecular docking to predict potential binding partners

  • Functional Genomics:

    • Gene knockout/knockdown studies in Clostridium botulinum

    • Transcriptomic analysis under various conditions

    • Protein-protein interaction studies using pull-down assays or yeast two-hybrid

    • Metabolomic changes in response to protein modulation

  • Biochemical Characterization:

    • Enzymatic activity assays with various substrates

    • Binding studies with potential ligands

    • Post-translational modification analysis

Understanding the UPF0316/DUF2179 family's broader distribution across 251 organisms according to COG data can provide valuable context for functional hypothesis generation .

How can researchers differentiate between E. coli-expressed and Baculovirus-expressed CLM_0701 in experimental validation?

Differentiating between E. coli-expressed and Baculovirus-expressed CLM_0701 is crucial for experimental validation and reproducibility:

  • Post-translational Modification Analysis:

    • Mass spectrometry to identify glycosylation patterns

    • Western blotting with glycan-specific antibodies

    • Phosphorylation site mapping

  • Activity Comparison:

    • Side-by-side functional assays to detect differences in activity

    • Thermal stability analysis to compare structural integrity

    • Circular dichroism to evaluate secondary structure differences

  • Immunological Detection:

    • Generation of antibodies specific to post-translational modifications

    • Differential immunoprecipitation techniques

    • Epitope mapping to identify system-specific differences

  • Biophysical Characterization:

    • Size-exclusion chromatography to analyze aggregation states

    • Dynamic light scattering for hydrodynamic radius determination

    • Surface plasmon resonance for binding kinetics comparison

These approaches enable researchers to determine whether the expression system significantly impacts protein function or structure, which is especially important when studying proteins of unknown function where subtle structural differences might affect experimental outcomes .

What is the relationship between CLM_0701 and other members of the UPF0316/DUF2179 family?

The relationship between CLM_0701 and other members of the UPF0316/DUF2179 family can be analyzed through evolutionary and structural comparisons:

  • Evolutionary Conservation:

    • CLM_0701 belongs to the COG4843 group, which is found in 251 out of 2,296 organisms analyzed in the COG database

    • The protein family has 290 gene members across these organisms

    • The median protein length of 185.69 amino acids suggests structural conservation

  • Structural Domain Analysis:

    • The DUF2179 domain is the defining characteristic of this family

    • Secondary structure predictions likely include conserved α-helices and β-sheets that may provide clues to function

    • Conserved residues across family members may indicate catalytic or binding sites

  • Functional Implications:

    • The conservation across diverse bacterial species suggests important biological roles

    • Genomic context analysis of CLM_0701 versus other family members may reveal functional associations

    • Co-expression patterns with known functional pathways could provide insights into biological roles

  • Host-Specific Adaptations:

    • Comparison between CLM_0701 from C. botulinum and homologs from other species may reveal host-specific adaptations

    • Variations in key residues might indicate functional specialization

Understanding these relationships provides a broader context for CLM_0701 research and may help researchers leverage findings from better-characterized family members .

How should researchers control for batch-to-batch variability when working with recombinant CLM_0701?

Controlling for batch-to-batch variability is essential for reproducible research with recombinant CLM_0701:

  • Quality Control Metrics:

    • Implement consistent SDS-PAGE analysis to verify the >85% purity specification

    • Develop and apply functional assays to test activity across batches

    • Utilize mass spectrometry to confirm protein identity and integrity

  • Reference Standards:

    • Maintain an internal reference standard from a well-characterized batch

    • Perform side-by-side testing of new batches against the reference

    • Establish acceptance criteria for batch release based on multiple parameters

  • Statistical Approaches:

    • Include batch information as a variable in experimental design

    • Use statistical methods such as mixed-effects models to account for batch effects

    • Consider normalization techniques when comparing data across batches

  • Documentation Practices:

    • Maintain detailed records of source, lot number, and production date

    • Document reconstitution procedures and storage conditions

    • Track freeze-thaw cycles and storage duration for all aliquots

By implementing these controls, researchers can minimize the impact of batch variability on experimental outcomes and improve data reliability .

What are the implications of using a partial recombinant CLM_0701 versus the full-length protein?

The implications of using partial recombinant CLM_0701 versus the full-length protein are significant for experimental design and data interpretation:

  • Structural Considerations:

    • Partial proteins may lack domains critical for proper folding or function

    • The three-dimensional structure may differ from the native conformation

    • Exposed hydrophobic regions could lead to aggregation or non-specific interactions

  • Functional Analysis:

    • Activity may be compromised if catalytic residues are missing or misaligned

    • Protein-protein interaction surfaces might be incomplete

    • Signal sequences or localization domains may be absent, affecting cellular studies

  • Experimental Design Adjustments:

    • Include appropriate controls to validate that the partial protein retains the function of interest

    • Consider domain-specific antibodies for detection and localization studies

    • Evaluate whether results from the partial protein can be extrapolated to the full-length version

  • Data Interpretation Caveats:

    • Clearly acknowledge limitations when reporting results obtained with partial proteins

    • Compare findings with computational predictions of full-length protein behavior

    • Consider complementary approaches to validate key findings

Researchers should carefully consider these factors when designing experiments and interpreting results with the partial recombinant CLM_0701 products available .

What are the most promising research applications for CLM_0701 based on current knowledge?

Based on current knowledge, several promising research applications for CLM_0701 can be identified:

  • Structural Biology Investigations:

    • Determining the three-dimensional structure of this uncharacterized protein could provide insights into its function

    • Comparative structural analysis with other UPF0316 family members may reveal evolutionary relationships

    • Structure-guided hypothesis generation for functional studies

  • Microbial Pathogenesis Research:

    • Investigating potential roles in Clostridium botulinum virulence or survival

    • Exploring interactions with host factors during infection

    • Evaluating conservation across pathogenic and non-pathogenic Clostridium species

  • Protein Family Characterization:

    • Using CLM_0701 as a model to understand the broader UPF0316/DUF2179 family

    • Establishing structure-function relationships for this protein family

    • Developing tools and resources for the research community studying uncharacterized proteins

  • Novel Therapeutic Target Evaluation:

    • Assessing essential functions in bacterial survival or pathogenesis

    • Exploring unique structural features for selective targeting

    • Developing screening assays for potential inhibitors

These applications represent opportunities to advance both fundamental knowledge about uncharacterized proteins and potential translational outcomes in understanding bacterial pathogens .

What methodological gaps need to be addressed to further characterize CLM_0701?

Several methodological gaps need to be addressed to advance CLM_0701 characterization:

  • Functional Assay Development:

    • Creation of robust activity assays based on structural predictions

    • Development of high-throughput screening methods for potential substrates

    • Establishment of interaction assays with predicted binding partners

  • In vivo Expression Systems:

    • Generation of tools for controlled expression in native Clostridium botulinum

    • Development of reporter systems to track localization and expression patterns

    • Creation of conditional knockout or depletion systems for functional studies

  • Structural Analysis Techniques:

    • Optimization of crystallization conditions for X-ray diffraction studies

    • Development of NMR methods for dynamic structural analysis

    • Refinement of computational prediction models for UPF0316 family proteins

  • Integrative Omics Approaches:

    • Integration of transcriptomics, proteomics, and metabolomics data

    • Development of computational frameworks to generate testable hypotheses

    • Standardization of data collection and analysis for comparative studies

Addressing these methodological gaps would significantly advance our understanding of CLM_0701 and potentially the entire UPF0316/DUF2179 protein family .

How might advances in computational biology contribute to understanding CLM_0701 function?

Advances in computational biology offer multiple avenues for understanding CLM_0701 function:

  • AI-Driven Structure Prediction:

    • Tools like AlphaFold2 provide increasingly accurate structural models

    • Predicted structures can inform hypothesis generation about potential binding pockets

    • Molecular dynamics simulations can explore conformational flexibility and potential binding events

  • Network Biology Approaches:

    • Prediction of functional associations through protein-protein interaction networks

    • Integrative analysis of gene co-expression data across multiple conditions

    • Identification of functional modules that include CLM_0701

  • Evolutionary Analysis Tools:

    • Detection of conserved residues under selective pressure as indicators of functional importance

    • Identification of co-evolving residues that might form functional interactions

    • Reconstruction of evolutionary history to understand functional divergence

  • Machine Learning Applications:

    • Development of function prediction algorithms based on sequence and structural features

    • Pattern recognition in large-scale experimental data to identify functional signatures

    • Transfer learning from better-characterized protein families to UPF0316 proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.