Recombinant Clostridium cellulolyticum Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Clostridium cellulolyticum EcfT Protein

The recombinant Clostridium cellulolyticum Energy-coupling factor transporter transmembrane protein EcfT (ecfT) is a heterologously expressed version of the native protein, engineered for research and biotechnological applications. EcfT is a core component of the energy-coupling factor (ECF) transporters, a subclass of ATP-binding cassette (ABC) transporters that mediate the uptake of micronutrients (e.g., vitamins, metal ions) in bacteria . In C. cellulolyticum, EcfT is part of a conserved "energizing module" that interacts with substrate-specific S-components to facilitate nutrient transport .

Role in ECF Transporters

EcfT is a transmembrane protein that, alongside two ATPases (EcfA and EcfA’), constitutes the "energy-coupling module" of ECF transporters. This module interacts with distinct S-components to enable substrate-specific transport . In C. cellulolyticum, EcfT is predicted to form a stable complex with multiple S-components, though experimental validation is limited .

Biochemical Features

  • Transmembrane Helices: EcfT contains hydrophobic regions that anchor the protein in bacterial membranes, enabling communication between the ATPase subunits and S-components .

  • Interaction with ATPases: The conserved "AxxxA" motif in EcfT’s transmembrane helix facilitates binding to the ATPases, ensuring coordinated ATP hydrolysis and substrate translocation .

Recombinant Expression Strategies

The recombinant ecfT protein is produced via heterologous expression in diverse systems:

SystemAdvantagesChallenges
E. coliHigh yield, cost-effectivePotential improper folding or insolubility
Yeast/BaculovirusEukaryotic post-translational modificationsHigher production costs
Mammalian cellsProper folding for functional studiesComplex protocols, limited scalability

Source:

Applications in Research and Biotechnology

ApplicationDetails
Vaccine DevelopmentUsed as an antigen to elicit immune responses against Clostridium pathogens
Metabolic EngineeringTarget for modulating nutrient uptake in cellulolytic bacteria
Transporter InhibitionModel system for screening ECF transporter inhibitors

Limited Functional Characterization

While structural models of C. cellulolyticum EcfT are inferred from homologs (e.g., Lactococcus lactis, Lactobacillus delbrueckii) , direct biochemical or biophysical studies on the recombinant protein are absent in publicly available literature. Key questions remain:

  1. Substrate Specificity: Does C. cellulolyticum EcfT interact with S-components for vitamins or metal ions?

  2. Thermodynamic Properties: How does ATP binding/hydrolysis influence EcfT’s conformational dynamics?

Potential for Industrial Applications

  • Biofuel Production: Engineering EcfT to enhance vitamin uptake could improve C. cellulolyticum’s ability to ferment lignocellulose into biofuels like ethanol .

  • Antibiotic Targets: ECF transporters are absent in humans, making them attractive targets for antimicrobial drugs .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes section, and we will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize developing the specified tag for your order.
Synonyms
ecfT; Ccel_0792; Energy-coupling factor transporter transmembrane protein EcfT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Target Names
ecfT
Target Protein Sequence
MIRDITIGQYVPGNSLLHKADPRTKIILTFIMMIFIFLINTYWGYLLLTLFTAITVVSSN IPVKFVLKGLKPILFIVVFAGIINIFMIKGTVIWSWGFLSITYEGINVAIKMAIRLFLLI ITASLLTYTTTPIALTDAIENLLAPLKRIKVPVHEIAMMMTIALRFIPTLLDETDKIIKA QSSRGADFDSGNMIERAKSFIPVLIPLFISAFRRADELATAMEARCYRGSEGRTRMKQLR FTRFDVLVTGITVVFMTWVILMEYVFF
Uniprot No.

Target Background

Function
Transmembrane (T) component of an energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transporters, this ECF transporter provides the energy required for the transport of a variety of substrates.
Database Links
Protein Families
Energy-coupling factor EcfT family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Energy-coupling factor transporter transmembrane protein EcfT in Clostridium cellulolyticum?

The EcfT protein functions as a core transmembrane component of Energy-coupling factor (ECF) transporters in C. cellulolyticum. ECF transporters represent a recently discovered family of primary active transporters responsible for uptake of essential micronutrients and vitamins, such as biotin and riboflavin . Within the transporter complex, EcfT serves as the transmembrane component that couples energy from ATP hydrolysis (performed by associated ATPase subunits) to the transport of specific substrates across the bacterial membrane.

What is the proposed structural organization of ECF transporters containing EcfT?

Research indicates that ECF transporters follow a 1A:1A':2T:2S (3 × 2) model, where two identical T subunits (EcfT) associate with two homologous ATPase subunits (A and A') and two substrate-binding S subunits . This assembly demonstrates twofold symmetry, which appears to be critical for transporter function. Each T subunit interacts with a conserved groove in the ATPase subunits, creating two membrane-embedded surfaces that can interact with integral membrane S subunits .

How does the EcfT protein contribute to nutrient transport mechanisms?

The EcfT protein serves as the critical coupling element that transduces conformational changes from the ATP-binding cassette domains to the substrate-binding domains. When ATP binds to the ATPase subunits (A and A'), it drives the transition to a closed dimer configuration, which converts the T subunits to an outward-facing conformation . This structural rearrangement appears to release tightly bound substrates from the attached S subunits, facilitating nutrient transport into the cell.

What purification strategies yield functional EcfT protein for structural and biochemical studies?

For purification of full-length recombinant EcfT protein, affinity chromatography using His-tag technology has proven effective . The addition of a histidine tag (commonly C-terminal) allows for purification via Ni-nitrilotriacetic acid columns, as demonstrated with other C. cellulolyticum proteins . To maintain protein stability and functionality, it's recommended to include protease inhibitors during lysis and purification steps, as C-terminal degradation has been observed in other recombinant C. cellulolyticum proteins .

What challenges might researchers encounter when isolating intact ECF transporter complexes containing EcfT?

Isolation of complete ECF transporter complexes presents significant challenges due to their multisubunit nature. Researchers should consider dual-tagging strategies - for example, using His-tagged EcfT combined with FLAG-tagged secondary subunits, which has successfully demonstrated complex assembly in other ECF transporters . Additionally, careful selection of detergents is critical for maintaining membrane protein stability and complex integrity during solubilization and purification procedures.

What biochemical assays can effectively measure EcfT functionality within ECF transporter complexes?

Functional assessment of EcfT within ECF transporters can be accomplished through ATP hydrolysis assays coupled with substrate transport measurements. ATP consumption can be monitored using colorimetric phosphate release assays, while substrate uptake can be tracked using radiolabeled or fluorescently labeled micronutrients. Additionally, reconstitution of purified complexes into proteoliposomes allows for direct measurement of transport activity and assessment of substrate specificity.

What advanced imaging techniques are most informative for studying EcfT structural dynamics?

For structural analysis of EcfT and its conformational changes during transport cycles, researchers should consider X-ray crystallography for static structures, as has been done with EcfA-A' dimers . For dynamic studies, hydrogen-deuterium exchange mass spectrometry can identify regions undergoing conformational changes during substrate binding and ATP hydrolysis. Single-molecule FRET (Förster Resonance Energy Transfer) experiments with strategically placed fluorophores can provide real-time information about EcfT dynamics during transport cycles.

How can protein-protein interactions between EcfT and other ECF transporter components be characterized?

Several complementary approaches can characterize EcfT interactions within the ECF complex. Pull-down assays using differentially tagged components (as demonstrated with His-tagged and FLAG-tagged subunits) can confirm physical associations . Surface plasmon resonance using a BIAcore biosensor-based analytical system, which has been applied to study interactions between other C. cellulolyticum proteins , provides quantitative binding kinetics. Cross-linking experiments, which have successfully identified dimeric T subunits in biotin ECF transporters, can capture transient interactions .

What genetic tools are available for modifying ecfT in C. cellulolyticum?

While genetic manipulation of clostridia has historically been challenging, recent advances have facilitated genetic engineering in C. cellulolyticum. Successful propagation of replicons has been achieved in this organism , enabling expression of heterologous genes. For EcfT modifications, researchers can employ shuttle vectors compatible with both E. coli and C. cellulolyticum, such as those containing erythromycin resistance markers (20 mg per liter) for selection of recombinant C. cellulolyticum strains .

How can researchers design site-directed mutagenesis experiments to probe EcfT functional motifs?

Effective site-directed mutagenesis strategies should target the conserved Ala-Arg motifs in EcfT, which have been identified as potential interaction sites with ATPase subunits . Mutations in these motifs would likely disrupt the binary interface with ATPase subunits, affecting energy coupling. Additionally, mutagenesis of residues in transmembrane helices 1-2-3, which form interaction surfaces with S subunits, could provide insights into substrate specificity and transport mechanisms .

What considerations are important when designing heterologous expression systems for EcfT structural variants?

When designing expression systems for EcfT variants, researchers must address codon usage differences between C. cellulolyticum and the host organism. Despite the presence of rarely used codons, heterologous expression in E. coli has generally been successful for clostridial proteins . For optimal expression, the inclusion of a strong, well-characterized ribosome binding site (RBS) upstream of the gene is recommended, as demonstrated during construction of artificial operons for expression in C. cellulolyticum .

How does EcfT-mediated nutrient transport integrate with C. cellulolyticum's metabolic pathways?

The EcfT protein, as part of ECF transporters, plays a crucial role in cellular metabolism by facilitating uptake of essential micronutrients and vitamins. In C. cellulolyticum, which has evolved to catabolize lignocellulosic materials in nutrient-limited environments, efficient nutrient acquisition systems are vital for survival . The ECF transporters likely provide essential cofactors needed for cellulose degradation enzymes and other metabolic processes, contributing to the organism's ability to grow on complex plant biomass substrates.

How does nutrient limitation affect EcfT expression and function in C. cellulolyticum?

As C. cellulolyticum has evolved to thrive in natural ecosystems where nutrients are rarely in saturating quantities, its nutrient transport systems are likely regulated in response to environmental availability . Under nutrient limitation, upregulation of ECF transporter components, including EcfT, would be expected to enhance nutrient scavenging capability. Researchers should consider examining EcfT expression levels under varying nutrient conditions using RT-qPCR or proteomics approaches to understand its regulatory mechanisms.

What is the relationship between EcfT-mediated transport and cellulolytic activity in C. cellulolyticum?

The relationship between nutrient acquisition via ECF transporters and cellulolytic activity represents an important area for investigation. C. cellulolyticum produces major cellulolytic enzymes like CelF that require cofactors for optimal activity, many of which could be transported by ECF systems. Researchers should examine whether limiting specific micronutrients transported by ECF complexes affects cellulase production or activity, potentially through enzymatic assays measuring cellulose degradation rates under varying nutrient conditions.

How conserved is EcfT structure and function across different Clostridium species?

Comparative genomic analysis of EcfT proteins across Clostridium species can reveal conserved functional domains and species-specific adaptations. Particular attention should be paid to the conserved Ala-Arg motifs that mediate interactions with ATPase subunits . Phylogenetic analysis of EcfT sequences, combined with functional characterization across species, would provide insights into evolutionary adaptations related to different ecological niches and substrate preferences.

What structural and functional differences exist between group I and group II ECF transporters containing EcfT?

ECF transporters are categorized into group I and group II based on their genetic organization and assembly mechanisms. While the search results focus primarily on group II transporters, researchers should investigate the specific characteristics of C. cellulolyticum EcfT to determine its classification. Group II ECF transporters typically have shared energizing modules that can interact with multiple S-components, allowing for transport of different substrates . Comparative structure-function analysis between groups can reveal mechanistic differences in transport cycles.

How do post-translational modifications affect EcfT function across different bacterial species?

Investigation of potential post-translational modifications (PTMs) in EcfT proteins across bacterial species could reveal regulatory mechanisms affecting transport function. While specific information on PTMs in C. cellulolyticum EcfT is not provided in the search results, researchers should consider phosphorylation, acetylation, or other modifications that might regulate protein-protein interactions within the complex or affect conformational changes during transport cycles.

How can structural information about EcfT be leveraged for rational design of transport inhibitors?

Structural data on ECF transporters, including the interactions between EcfT and other components, provides a foundation for rational design of inhibitors that could disrupt nutrient acquisition in pathogenic clostridia. Researchers should focus on the conserved interfaces between EcfT and ATPase subunits or the coupling mechanism between EcfT and S-components . Virtual screening of compound libraries against these interfaces, followed by experimental validation of binding and inhibition, could yield selective inhibitors for research or therapeutic applications.

What approaches can be used to investigate the real-time dynamics of EcfT during transport cycles?

Real-time investigation of EcfT dynamics presents significant challenges due to the transmembrane nature and complex conformational changes involved in transport. Advanced approaches include single-molecule FRET with strategically placed fluorophores to track distance changes between domains during transport cycles. Additionally, hydrogen-deuterium exchange mass spectrometry at different stages of the transport cycle can identify regions undergoing conformational changes. Time-resolved cryo-electron microscopy might capture different conformational states of the complete ECF transporter complex.

How might synthetic biology approaches incorporate engineered EcfT variants for novel substrate transport?

Synthetic biology offers opportunities to engineer EcfT for novel functions, such as transport of non-native substrates or enhanced transport efficiency. By identifying and modifying the interfaces between EcfT and substrate-binding S-components, researchers might redirect substrate specificity. The demonstrated ability of ECF transporters to accommodate two different S subunits simultaneously suggests potential for creating hybrid transporters with expanded substrate ranges. Domain swapping experiments between EcfT proteins from different species could also generate chimeric transporters with novel properties.

What are the main technical challenges in obtaining high-resolution structural data for the complete ECF transporter complex containing EcfT?

Obtaining high-resolution structural data for complete ECF transporter complexes presents several challenges. The membrane-embedded nature of these multicomponent complexes complicates crystallization attempts. While structures of individual components (such as the EcfA-A' heterodimer) have been solved , capturing the complete complex in functionally relevant conformations remains challenging. Advanced approaches such as cryo-electron microscopy combined with cross-linking strategies to stabilize specific conformational states may provide breakthroughs in understanding the complete structure.

How can emerging technologies address current knowledge gaps regarding EcfT conformational changes during transport?

Emerging technologies that could address knowledge gaps include advanced simulation methods such as molecular dynamics to model conformational changes based on partial structural data. Enhanced sampling techniques can predict transitions between different states of the transport cycle. Additionally, development of conformation-specific nanobodies or synthetic binding proteins could trap and stabilize specific states for structural analysis. Single-particle tracking methods might reveal heterogeneity in transport behavior at the molecular level.

What potential biotechnological applications might exploit engineered EcfT variants in metabolic engineering of C. cellulolyticum?

Engineered EcfT variants could significantly impact metabolic engineering efforts in C. cellulolyticum, particularly for improved biomass conversion. Enhanced uptake of essential micronutrients could potentially alleviate metabolic bottlenecks in cellulose fermentation, similar to how addressing pyruvate accumulation through heterologous gene expression improved cellulose consumption by 150% . By engineering ECF transporters for enhanced cofactor uptake, researchers might improve cellulolytic enzyme production and activity, potentially contributing to more efficient biofuel or biochemical production from cellulosic feedstocks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.