Recombinant Clostridium cellulolyticum Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please contact your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize the development of the specified tag.
Synonyms
crcB; Ccel_1873; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Target Names
crcB
Target Protein Sequence
MKEMINVVAVGTGGFVGAASRYFISTLVNKLNTSGFPIATLIINILGSFLIGLLTQLLMS LCPDNKKLNLFLTTGILGGFTTFSTFSLETVNLFQGGKAVFGVVNIVLSIAFCLTGVVLG KMLAKTIASM
Uniprot No.

Target Background

Function
CrcB plays a crucial role in reducing fluoride concentration within the cell, thus mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of CrcB homolog protein in bacterial species?

CrcB homolog proteins function primarily as fluoride ion transporters in bacterial species, including Clostridium cellulolyticum. These membrane proteins are crucial for fluoride homeostasis, protecting bacteria against the toxic effects of environmental fluoride by facilitating its export from the cell. Based on homology with other bacterial species, the CrcB protein typically contains transmembrane domains that form channels specific for fluoride ions .

Understanding this function is essential for researchers investigating bacterial resistance mechanisms and membrane transport systems. The protein's role extends beyond simple ion transport to potentially influencing bacterial colonization and survival in fluoride-containing environments.

How does recombinant CrcB protein expression differ between bacterial host systems?

  • E. coli expression systems often produce CrcB in inclusion bodies, requiring refolding protocols for functional studies

  • Expression in the native Clostridium species may provide better folding but lower yields

  • Alternative hosts like Bacillus subtilis might provide a compromise for membrane protein expression

The expression conditions must be carefully optimized for temperature, induction timing, and media composition. For example, expression at lower temperatures (16-20°C) often improves the solubility of membrane proteins like CrcB .

What purification strategies are most effective for recombinant CrcB homolog proteins?

Purifying recombinant CrcB homolog requires specialized approaches due to its membrane-associated nature. Based on similar proteins, a methodological approach would include:

  • Solubilization using appropriate detergents (typically CHAPS, DDM, or Triton X-100)

  • Affinity chromatography utilizing N-terminal or C-terminal tags (His-tags are commonly employed)

  • Size exclusion chromatography to improve purity and remove aggregates

  • Optional ion exchange chromatography depending on the protein's isoelectric point

For His-tagged CrcB homolog proteins, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin provides good initial purification. Researchers should maintain detergent concentrations above the critical micelle concentration throughout purification to prevent protein aggregation and precipitation .

How can researchers design experimental systems to study CrcB transport function?

Designing experimental systems to study CrcB fluoride transport function requires multidisciplinary approaches:

Fluoride Transport Assays:

  • Liposome reconstitution systems loaded with fluoride-sensitive dyes

  • Patch-clamp techniques for direct measurement of ion currents

  • Radioactive 18F-labeling for direct transport measurement

  • Fluoride-sensitive electrode studies in whole cells versus membrane vesicles

Control Design Considerations:

  • Include empty vector controls without CrcB

  • Use site-directed mutagenesis to create non-functional CrcB variants

  • Compare wild-type and knockout strains

  • Test transport specificity with other halides (Cl-, Br-, I-)

Experimental Variables to Consider:

  • pH dependence (typically 6.0-8.0)

  • Membrane potential effects

  • Temperature dependence (15-37°C)

  • Concentration gradients (typically 0.1-10 mM F-)

When designing these experiments, researchers should implement between-subjects or within-subjects approaches depending on their specific questions. Between-subjects designs are valuable when comparing different CrcB variants, while within-subjects designs might be more appropriate for examining concentration-dependent effects .

What are the methodological approaches for analyzing homologous recombination events in CrcB genes across bacterial species?

Analyzing homologous recombination in CrcB genes requires sophisticated genomic and bioinformatic approaches similar to those used in other bacterial species studies. A methodological framework includes:

  • Sequence Alignment and Phylogenetic Analysis:

    • Multiple sequence alignment of CrcB genes from diverse bacterial sources

    • Construction of phylogenetic trees using maximum likelihood or Bayesian approaches

    • Detection of discordant phylogenies as evidence of recombination events

  • Recombination Detection Methods:

    • Four-gamete test to identify minimum number of recombination events

    • Analysis of mosaic structures through sliding window approaches

    • Calculation of recombination rate considering nucleotide diversity (π)

  • Statistical Analysis:

    • Regression analysis between nucleotide diversity and recombination events

    • Identification of genes with particularly high or low recombination rates

    • Permutation tests to evaluate statistical significance

What techniques are available for structural characterization of CrcB homolog proteins?

Structural characterization of membrane proteins like CrcB requires specialized approaches:

X-ray Crystallography Approach:

  • Detergent screening (typically 20-30 detergents) to identify optimal solubilization conditions

  • Lipidic cubic phase crystallization for membrane proteins

  • Synchrotron radiation for data collection from microcrystals

  • Molecular replacement using homologous structures for phase determination

Cryo-EM Methods:

  • Detergent micelles or nanodiscs for protein stabilization

  • Vitrification conditions optimization (-160 to -180°C)

  • Data processing with motion correction and 3D reconstruction

  • Resolution enhancement through particle subtraction techniques

Complementary Techniques:

  • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • FTIR spectroscopy for secondary structure analysis

  • Fluorescence resonance energy transfer (FRET) for conformational studies

  • Cross-linking mass spectrometry for topology mapping

These approaches should be complemented with functional assays to correlate structure with transport activity, particularly focusing on the transmembrane domains likely involved in fluoride ion transport.

What are the optimal storage and handling conditions for recombinant CrcB protein preparations?

Proper storage and handling of recombinant CrcB protein is critical for maintaining functional integrity:

Short-term Storage (1-7 days):

  • Store at 4°C in appropriately buffered solution (typically Tris/PBS-based buffer, pH 7.5-8.0)

  • Include stabilizing agents such as glycerol (5-10%) or trehalose (6%)

  • Maintain detergent concentration above critical micelle concentration

Long-term Storage:

  • Store at -20°C/-80°C with cryoprotectants (final glycerol concentration 20-50%)

  • Aliquot to avoid repeated freeze-thaw cycles which can cause protein denaturation

  • Consider lyophilization in the presence of stabilizers for ambient temperature storage

Handling Recommendations:

  • Briefly centrifuge vials before opening to bring contents to the bottom

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • For buffer exchange, use dialysis with low molecular weight cutoff membranes (10-12 kDa)

  • Handle at 4°C whenever possible to minimize degradation

Following these protocols will help maintain protein stability and functional integrity throughout experimental procedures.

How can researchers verify the functional integrity of purified recombinant CrcB homolog protein?

Verifying functional integrity of purified CrcB requires multiple complementary approaches:

Biochemical Characterization:

  • SDS-PAGE for purity assessment (>90% is typically considered acceptable)

  • Circular dichroism spectroscopy to confirm secondary structure integrity

  • Size exclusion chromatography to verify homogeneity and detect aggregation

  • Thermal shift assays to assess protein stability

Functional Assays:

  • Fluoride binding assays using isothermal titration calorimetry

  • Fluoride transport in reconstituted proteoliposomes

  • Membrane incorporation assessment using fluorescence microscopy

  • Complementation assays in CrcB-deficient bacterial strains

Activity Benchmarks:

  • Compare activity with native protein when possible

  • Establish dose-response relationships for fluoride transport

  • Determine kinetic parameters (Km, Vmax) for transport activity

  • Verify specificity using competitive inhibitors

A combination of these approaches provides comprehensive validation of protein functionality before proceeding with advanced experimental studies.

What controls and variables should be considered when studying fluoride resistance conferred by CrcB homolog proteins?

When studying fluoride resistance mechanisms mediated by CrcB, researchers should implement comprehensive controls and consider multiple variables:

Essential Controls:

Control TypePurposeImplementation
Negative ControlBaseline fluoride sensitivityCrcB knockout or empty vector
Positive ControlMaximum fluoride resistanceNative CrcB expression
Specificity ControlIon selectivity verificationOther halide ions (Cl-, Br-, I-)
Expression ControlNormalization for protein levelsWestern blot quantification

Critical Variables:

  • Fluoride concentration range (typically 0.5-50 mM)

  • Growth media composition (particularly relevant cations)

  • pH (fluoride toxicity is pH-dependent)

  • Growth temperature (affects membrane fluidity and protein function)

  • Exposure time (acute vs. chronic fluoride stress)

Experimental Design Considerations:

  • Use randomized block design to control for batch effects

  • Implement appropriate statistical analysis (ANOVA followed by post-hoc tests)

  • Consider genetic background effects in different bacterial strains

  • Account for potential compensatory mechanisms

Random assignment to experimental conditions is crucial to ensure internal validity and minimize systematic biases that could confound the results .

How can comparative genomics approaches be applied to study CrcB homolog evolution across bacterial species?

Comparative genomics offers powerful insights into CrcB evolution and adaptation:

Methodological Approach:

  • Database Mining and Sequence Collection:

    • Extract CrcB homologs from genomic databases (NCBI, UniProt)

    • Classify by bacterial phyla, environmental niche, and pathogenicity

    • Include both close and distant homologs for comprehensive analysis

  • Evolutionary Analysis:

    • Calculate selection pressures (dN/dS ratios) across protein domains

    • Identify conserved motifs using MEME and related algorithms

    • Detect horizontal gene transfer events using composition-based methods

    • Analyze synteny of genomic regions containing CrcB genes

  • Structure-Function Correlation:

    • Map sequence conservation onto predicted structural models

    • Identify co-evolving residues using mutual information analysis

    • Correlate evolutionary patterns with fluoride concentration in natural habitats

  • Recombination Analysis:

    • Calculate minimum number of recombination events per nucleotide

    • Analyze the relationship between nucleotide diversity and recombination rate

    • Identify recombination hotspots within the gene sequence

This approach can reveal how CrcB proteins have evolved different fluoride transport efficiencies or substrate specificities across bacterial species, particularly in relation to environmental adaptation and horizontal gene transfer events .

What expression vector systems provide optimal results for recombinant CrcB protein production?

Selecting appropriate expression vectors for CrcB protein production requires consideration of multiple factors:

Recommended Vector Systems:

Critical Vector Elements:

  • Strong but controllable promoters (T7, tac, or arabinose-inducible)

  • Optimal codon usage for the expression host

  • Appropriate fusion tags (His, FLAG, or Strep II for purification)

  • Fusion protein cleavage sites (TEV or PreScission protease sites)

  • Signal sequences for membrane targeting if needed

Recombinant CrcB requires careful consideration of membrane protein-specific challenges, including toxicity when overexpressed and proper membrane insertion. Modifying induction conditions (temperature, inducer concentration, and induction timing) often proves crucial for successful expression .

What are the most effective protocols for reconstituting CrcB proteins into liposomes for functional studies?

Reconstituting CrcB proteins into liposomes requires careful optimization:

Methodological Protocol:

  • Liposome Preparation:

    • Select lipid composition (typically E. coli lipid extract or POPC/POPG mixtures)

    • Prepare lipid films by rotary evaporation

    • Hydrate with buffer containing fluoride-sensitive probes if needed

    • Extrude through polycarbonate filters (100-200 nm) for uniform size

  • Protein Incorporation:

    • Solubilize purified CrcB in mild detergents (DDM, OG, or CHAPS)

    • Mix with preformed liposomes at protein:lipid ratios of 1:50 to 1:500

    • Remove detergent by dialysis or Bio-Beads adsorption

    • Verify incorporation by density gradient centrifugation

  • Functional Verification:

    • Assess protein orientation using protease protection assays

    • Measure fluoride transport using ion-selective electrodes

    • Evaluate membrane integrity through calcein leakage assays

    • Visualize proteoliposomes using electron microscopy or fluorescence techniques

Optimizing the reconstitution protocol often requires testing multiple detergents, lipid compositions, and protein:lipid ratios to achieve functional incorporation. The presence of specific lipids may be crucial for proper CrcB folding and activity.

How can site-directed mutagenesis be applied to identify critical residues in CrcB homolog proteins?

Site-directed mutagenesis provides crucial insights into CrcB structure-function relationships:

Systematic Approach:

  • Target Selection:

    • Conserved residues based on multiple sequence alignments

    • Charged residues within predicted transmembrane domains

    • Residues with distinctive conservation patterns across bacterial phyla

    • Putative fluoride coordination sites based on homology models

  • Mutagenesis Strategy:

    • Alanine scanning of selected regions

    • Conservative substitutions (e.g., Asp→Glu) to test charge requirements

    • Cysteine substitutions for accessibility studies

    • Introduction of reporter groups for spectroscopic studies

  • Functional Characterization:

    • Fluoride transport assays in reconstituted systems

    • Growth complementation in CrcB-deficient strains

    • Protein stability and folding assessment

    • Localization and membrane insertion verification

  • Data Analysis:

    • Structure-function correlation through homology modeling

    • Identification of residue networks through double mutant cycle analysis

    • Energetic contribution to fluoride binding and transport

This methodological approach can identify the molecular determinants of fluoride selectivity and transport, providing insights into the evolutionary adaptation of CrcB proteins in different bacterial species.

How can CrcB homolog research contribute to understanding bacterial fluoride resistance mechanisms?

CrcB homolog research offers significant insights into bacterial fluoride resistance:

Fundamental Contributions:

  • Elucidation of molecular mechanisms underlying fluoride toxicity

  • Identification of resistance determinants across bacterial species

  • Understanding evolutionary adaptations to fluoride-rich environments

  • Characterization of membrane transport systems with unique ion selectivity

Methodological Approaches:

  • Comparative Genomics:

    • Analyze CrcB distribution across bacterial phyla

    • Correlate CrcB variants with environmental fluoride levels

    • Study co-evolution with other fluoride resistance determinants

  • Functional Characterization:

    • Determine transport kinetics and energy coupling mechanisms

    • Investigate regulation of CrcB expression under stress conditions

    • Examine interactions with other membrane components

  • Structural Biology:

    • Resolve CrcB structure to understand fluoride selectivity

    • Map the transport pathway through molecular dynamics simulations

    • Identify key residues through mutagenesis and functional studies

Future research in this area will likely reveal novel insights into ion channel selectivity principles and bacterial adaptation to extreme environments, with potential applications in synthetic biology and antimicrobial development.

What are the key considerations in designing experiments to analyze recombination events in bacterial CrcB genes?

Analyzing recombination in bacterial CrcB genes requires careful experimental design:

Experimental Design Framework:

  • Sampling Strategy:

    • Include diverse bacterial isolates across phylogenetic groups

    • Sample from various ecological niches with different fluoride concentrations

    • Consider both clinical and environmental isolates

    • Ensure adequate sample size for statistical power

  • Sequencing Approach:

    • Whole genome sequencing to capture genomic context

    • Targeted deep sequencing of CrcB loci for higher coverage

    • Long-read sequencing to detect structural variations

    • Metagenomic approaches for unculturable organisms

  • Analytical Methods:

    • Apply minimum number of recombination events (Rmin) calculations

    • Analyze relationship between nucleotide diversity and recombination rate

    • Identify recombination breakpoints using multiple algorithms

    • Map recombination hotspots to functional domains

  • Validation Strategies:

    • Laboratory evolution experiments under fluoride stress

    • Transformation assays to measure recombination frequency

    • Heterologous expression to verify functional consequences

    • Construction of chimeric proteins to test domain swapping

Researchers should consider both between-subjects and within-subjects experimental designs depending on their specific questions, ensuring appropriate controls and random assignment to minimize systematic biases .

How can advanced molecular dynamics simulations contribute to understanding CrcB transport mechanisms?

Molecular dynamics (MD) simulations provide atomic-level insights into CrcB function:

Simulation Strategy:

  • System Preparation:

    • Build homology models based on related structures

    • Embed protein in lipid bilayers mimicking bacterial membranes

    • Add explicit solvent and ions at physiological concentrations

    • Incorporate fluoride ions at various concentrations

  • Simulation Protocols:

    • Equilibration with position restraints on protein

    • Production runs (typically 100-500 ns) under NPT conditions

    • Enhanced sampling techniques (umbrella sampling, metadynamics)

    • Coarse-grained simulations for longer timescales

  • Analysis Approaches:

    • Identify fluoride binding sites and coordination geometry

    • Calculate free energy profiles for ion permeation

    • Analyze protein conformational changes during transport

    • Examine water and ion dynamics within the channel

  • Validation Methods:

    • Correlate simulation predictions with mutagenesis results

    • Compare calculated transport rates with experimental measurements

    • Test structural predictions using spectroscopic data

    • Design experiments to verify predicted mechanistic details

These simulations can reveal the molecular basis of fluoride selectivity, conformational changes associated with transport, and the energetics of ion permeation through CrcB proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.