Recombinant Clostridium cellulolyticum UPF0059 membrane protein Ccel_1412 (Ccel_1412)

Shipped with Ice Packs
In Stock

Description

Introduction to Clostridium cellulolyticum and Membrane Proteins

Clostridium cellulolyticum is a non-ruminal mesophilic cellulolytic bacterium originally isolated from decayed grass. As a member of the Clostridium genus, which encompasses approximately 100 species including both common free-living bacteria and significant pathogens, C. cellulolyticum has distinctive characteristics including its endospores with a bowling pin or bottle shape . This anaerobic, Gram-positive bacterium has garnered significant scientific interest primarily due to its ability to efficiently degrade cellulose, the most abundant renewable carbon source on Earth.

C. cellulolyticum possesses an extracellular multi-enzymatic complex called the cellulosome, which is responsible for breaking down cellulose into soluble cello-oligosaccharides that support bacterial growth . These cellulosomes release soluble products from cellulose, providing primary carbon substrates essential for the organism's metabolism. The bacterium has been characterized by relatively limited carbon consumption and subsequent restricted growth compared to other saccharolytic clostridia .

Membrane proteins play crucial roles in bacterial physiology, including substrate sensing, transport of molecules across cellular membranes, signal transduction, and maintenance of cellular homeostasis. The UPF0059 designation indicates an uncharacterized protein family with the numerical identifier 0059, representing proteins with conserved sequence features but incompletely determined functions. Within this context, the Ccel_1412 protein represents a specific membrane protein from C. cellulolyticum belonging to this family.

Potential Roles in Cellular Processes

As a membrane protein in a cellulolytic bacterium, Ccel_1412 might participate in processes related to cellulose utilization, which is central to C. cellulolyticum metabolism. In related bacteria such as Ruminiclostridium cellulolyticum, membrane proteins and associated systems play crucial roles in detecting and importing cellulose breakdown products.

For instance, the CuaABC ATP-binding cassette transporter and its associated solute-binding protein CuaA are essential for cellobiose and cellulose utilization in R. cellulolyticum . Similarly, another solute-binding protein, CuaD, allows microorganisms to detect very low concentrations of cellobiose due to its high affinity and specificity for this disaccharide . While Ccel_1412 has not been directly implicated in similar functions, membrane proteins in cellulolytic bacteria often participate in substrate sensing, transport, or signaling.

Comparative Functional Context

C. cellulolyticum possesses various cellulosomal and non-cellulosomal proteins involved in cellulose degradation, such as CelE, a multidomain cellulase that represents one of the three major proteins of the cellulosome . CelE exhibits activity on p-nitrophenyl-cellobiose and acts synergistically with other cellulases, releasing primarily cellobiose from cellulosic substrates .

While Ccel_1412 is not identified as a cellulase, its presence in a cellulolytic bacterium suggests potential involvement in cellular processes related to this primary metabolic function. Membrane proteins often serve as sensors for environmental substrates or participate in transporting breakdown products into the cell.

Recombinant Production Systems for Ccel_1412

The recombinant production of membrane proteins presents significant technical challenges due to their hydrophobic nature and requirements for proper folding and membrane insertion. For Ccel_1412, several expression systems have been identified as potential production platforms.

Expression Systems

According to available information, recombinant Ccel_1412 protein can be produced in various heterologous expression systems, including Escherichia coli, yeast, baculovirus-infected insect cells, or mammalian cell expression systems . Each system offers distinct advantages and challenges for membrane protein production.

Table 2: Expression Systems for Recombinant Production of Ccel_1412

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, rapid growth, economicalPotential inclusion body formation, limited post-translational modificationsAntigen production, preliminary studies
YeastEukaryotic folding machinery, scalableLonger production time, different codon usageFunctional studies requiring proper folding
Baculovirus/Insect CellsProper folding of complex proteins, post-translational modificationsComplex setup, higher costStructural studies, functional assays
Mammalian CellsMost native-like folding and modificationsHighest cost, lowest yieldFunctional studies requiring mammalian-like processing

Purification and Quality Assessment

Purification of recombinant membrane proteins typically involves detergent solubilization followed by chromatographic techniques. For research applications, purified Ccel_1412 would likely undergo quality assessment to verify its identity, purity, and structural integrity before use in downstream applications.

The production of properly folded recombinant membrane proteins often represents a significant bottleneck in research. Recent advances in computational design of soluble functional analogues of integral membrane proteins, as demonstrated with other challenging membrane proteins, could potentially be applied to create more easily produced versions of Ccel_1412 while maintaining key structural features .

Applications in Research and Biotechnology

Recombinant Ccel_1412 protein has potential applications in various research and biotechnological contexts, with specific emphasis on vaccine development and molecular research.

Research Applications

In fundamental research, purified Ccel_1412 could serve as a model for studying the structural and functional characteristics of the UPF0059 family, contributing to our understanding of bacterial membrane protein biology. Such research might include:

  1. Structural characterization using techniques such as X-ray crystallography, cryo-electron microscopy, or computational modeling

  2. Protein-protein interaction studies to identify binding partners

  3. Functional assays to determine biological activities

  4. Comparative analyses with homologous proteins from related bacterial species

Biotechnological Potential

Given C. cellulolyticum's importance in biomass degradation, proteins involved in its membrane functions might have biotechnological applications in biofuel production or biomass conversion. If future research demonstrates that Ccel_1412 participates in processes related to cellulose utilization, understanding its function could contribute to engineering more efficient cellulose-degrading bacterial strains.

Future Research Directions

Despite the available information, significant knowledge gaps remain regarding Ccel_1412. Future research priorities might include:

Functional Analysis

Elucidating the biological function of Ccel_1412 represents a critical research direction. Approaches might include:

  1. Gene deletion or mutation studies in C. cellulolyticum to observe phenotypic effects

  2. Heterologous expression in model organisms followed by functional assays

  3. Protein interaction studies to identify binding partners

  4. Comparative genomics examining the genetic context of UPF0059 family genes across bacterial species

Applied Research

Exploring the practical applications of Ccel_1412 in biotechnology and medicine could include:

  1. Evaluation of its potential as a vaccine component against pathogenic Clostridium species

  2. Investigation of its role in cellulose metabolism for biofuel applications

  3. Assessment as a potential target for antimicrobial development

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
In general, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; Ccel_1412; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Target Names
mntP
Target Protein Sequence
MSLTELILLAIGLSMDASAVSISNSLCIKKIKIKHILQMAVMFAVFQGIMPLIGYYAANS FENVIERFDHWIAFILLVIIGGKMIHESITADEEQDCSLFSLTFKLLLVQAVATSIDALA VGVSLSALNVDILYSITIIGIVTFICCTAAILLANRFGNLLGKRAGIVGGLILVGIGVKI FVQHMFFGG
Uniprot No.

Target Background

Function
Likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Structural and Functional Characterization of Ccel_1412

Q1: What structural domains or motifs have been identified in Ccel_1412, and how do they relate to its putative function?

Ccel_1412 (UniProt: B8I1G8) is a 189-amino acid membrane protein with a predicted N-terminal His-tag fusion. Bioinformatics analysis suggests potential membrane-anchoring domains, though specific motifs (e.g., transmembrane helices, binding sites) remain uncharacterized. Functional studies are critical to validate its role in anchoring cellulosomes or interacting with cell wall components .

Q2: How does Ccel_1412 differ from other scaffolding proteins like CipC in Clostridium cellulolyticum?

Unlike CipC, which contains CBM3a domains for cellulose binding and dockerin modules for cellulosome assembly, Ccel_1412 lacks identifiable catalytic or cohesin modules. Its membrane localization suggests a distinct role, possibly in maintaining cellulosome proximity to the cell surface .

Experimental Design and Validation

Q3: What methodologies are recommended to validate the recombinant Ccel_1412 protein’s structural integrity?

  • SDS-PAGE and Western blotting: Confirm molecular weight (~21 kDa) and His-tag presence using anti-His antibodies.

  • Circular dichroism (CD) or NMR: Assess secondary structure composition (e.g., α-helices, β-sheets).

  • Cellular localization assays: Use fluorescence microscopy with membrane markers to confirm localization in C. cellulolyticum .

Q4: How can researchers address potential inconsistencies in Ccel_1412 functional studies?

ApproachPurposeLimitations
Gene knockout/complementationAssess phenotypic changes in cellulose bindingPolar effects on adjacent genes in operons
Protein-protein interaction assays (e.g., pull-downs)Identify binding partners (e.g., cellulosomal components)Requires purified proteins and controlled conditions
Bioinformatics reannotationReassess domain predictions using updated tools (e.g., InterPro)Relies on algorithmic accuracy

Advanced Research Applications

Q5: What strategies can be employed to elucidate Ccel_1412’s role in cellulosome organization?

  • Co-expression with cellulosome components: Test interactions with CipC, Cel48F, or Cel9E in recombinant systems.

  • Cell wall binding assays: Measure Ccel_1412’s affinity for cell wall fractions using surface plasmon resonance (SPR).

  • Cryo-EM or X-ray crystallography: Resolve structural interactions with membrane or cellulosomal proteins .

Q6: How does Ccel_1412’s membrane localization influence its potential as a vaccine target?

While recombinant Ccel_1412 is marketed for vaccine development , its role in pathogenesis remains unclear. Comparative studies against Clostridium pathogens (e.g., C. difficile) are needed to validate immunogenicity. Structural insights into epitope regions could guide subunit vaccine design.

Data Analysis and Interpretation

Q7: What computational tools are effective for analyzing Ccel_1412’s genomic context and evolutionary relationships?

ToolApplicationExample Output
DIAMOND/BLASTHomolog identification across Clostridium speciesPercentage identity to C. thermocellum proteins
PSI-BLASTDomain family identificationPrediction of membrane-spanning regions
STRING or COXPRESdbProtein interaction networksHypothetical partners in cellulosome assembly

Q8: How should researchers interpret conflicting data on Ccel_1412’s function from different studies?

  • Reproducibility checks: Validate findings across multiple strains (e.g., wild-type vs. cipC mutants).

  • Meta-analysis: Compare experimental conditions (e.g., growth substrates, protein expression levels).

  • Hypothesis-driven testing: Design experiments to resolve discrepancies (e.g., testing membrane vs. cytoplasmic localization) .

Future Research Directions

Q9: What unresolved questions remain regarding Ccel_1412’s biochemical and ecological significance?

  • Mechanism of action: Does it directly anchor cellulosomes, or regulate their expression?

  • Environmental adaptation: How does Ccel_1412 contribute to cellulose degradation efficiency in anaerobic conditions?

  • Synergistic interactions: Does it collaborate with SLH domain proteins for cell wall adhesion?

Q10: How can Ccel_1412 be leveraged in synthetic biology applications?

  • Biohybrid systems: Engineer Ccel_1412 fusions to anchor recombinant cellulosomes to non-native hosts.

  • Bioreactor optimization: Use Ccel_1412 as a marker for membrane integrity in cellulolytic consortia.

  • Biomaterial design: Investigate its potential in stabilizing enzymatic complexes for industrial processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.