Recombinant Clostridium cellulovorans Cobalt transport protein CbiM (cbiM)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
cbiM; Clocel_2220; Cobalt transport protein CbiM; Energy-coupling factor transporter probable substrate-capture protein CbiM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-260
Protein Length
Full Length of Mature Protein
Species
Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B)
Target Names
cbiM
Target Protein Sequence
MHIMEGYLSPKWCIIWGILVLPFLIKGSLNVKKVVSDDQRIKLLFAMAGAFIFILSALKL PSFTGTSSHPTGIGLSTILFGPAITTVLGVIVLLFQALLLAHGGISTLGANSFAMAVMGP LMAYGVYKILQKIKIPQNINIFFSATVGDLFTYCITAIQLGIDHPLEYDGIFASIERYLG VFAITQIPIAIAEGILTVLIFNVIAKYSSKELGKLGILNNSEEAEL
Uniprot No.

Target Background

Function
Component of the energy-coupling factor (ECF) transporter complex CbiMNOQ, involved in cobalt import.
Database Links
Protein Families
CbiM family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CbiM and what is its structural relationship to the cobalt transport system?

CbiM is a membrane substrate-binding component of the CbiMNQO complex, which functions as an energy-coupling factor (ECF) transporter in the ATP-binding cassette (ABC) transporter superfamily. In the context of Clostridium cellulovorans, CbiM corresponds to the EcfS component found in group-II ECF transporters . The complete cobalt transport system consists of:

  • CbiM/CbiN: Function as the substrate-binding subunits (analogous to EcfS)

  • CbiQ: Acts as the integral membrane scaffold component (analogous to EcfT)

  • CbiO: Serves as the cytoplasmic ATP binding/hydrolysis component (analogous to EcfA)

The structural organization enables the complex to bind cobalt ions and transport them across the cell membrane through conformational changes powered by ATP hydrolysis.

How can researchers express and purify recombinant CbiM for functional studies?

Expression and purification of recombinant CbiM typically involves:

  • Cloning Strategy: The cbiM gene should be PCR-amplified from C. cellulovorans genomic DNA and inserted into an expression vector with an appropriate affinity tag (His-tag is commonly used).

  • Expression System Selection: Given that CbiM is a membrane protein, specialized expression systems are required:

    • E. coli strains optimized for membrane protein expression (C41, C43)

    • Cell-free expression systems

    • Homologous expression in Clostridium species

  • Purification Protocol:

    • Membrane fraction isolation through ultracentrifugation

    • Solubilization with appropriate detergents (DDM, LDAO)

    • Affinity chromatography using the attached tag

    • Size exclusion chromatography for final purity

Functional integrity can be verified through binding assays with radioactive cobalt isotopes or fluorescently labeled cobalt analogs.

What experimental approaches are used to study CbiM-substrate interactions?

Several methodological approaches are utilized to investigate CbiM-substrate interactions:

  • Isothermal Titration Calorimetry (ITC): Provides thermodynamic parameters of cobalt binding

  • Surface Plasmon Resonance (SPR): Measures real-time binding kinetics

  • Fluorescence-based Assays: Using intrinsic tryptophan fluorescence or fluorescent analogs

  • Radioactive Assays: With 57Co or 60Co to track transport

  • Structural Studies: X-ray crystallography and cryo-EM to visualize binding sites

Researchers can determine binding affinity constants and specificity by comparing CbiM's interaction with cobalt versus other divalent metal ions.

How does the cellular location of CbiM affect its function?

CbiM functions primarily at the cell membrane, serving as an integral component of the cobalt transport machinery. Drawing parallels from research on C. cellulovorans' CbpA protein and its hydrophilic domains (HLDs), we can infer that proper localization of transport proteins is critical for function.

Similar to how CbpA's hydrophilic domains aid in binding cellulosome complexes to the cell surface , the correct localization of CbiM within the membrane is essential for:

  • Proper assembly of the complete CbiMNQO transport complex

  • Optimal orientation for cobalt binding from the extracellular environment

  • Efficient interaction with the energy-coupling components (CbiO) that power the transport process

Disruptions in membrane localization would likely diminish transport efficiency, as has been demonstrated in similar ABC transporter systems.

What methodological approaches can resolve conflicting data on CbiM's transport mechanism?

When facing contradictory findings regarding CbiM's transport mechanism, researchers should consider a multi-faceted approach:

  • Complementary Structural Techniques:

    • Combine X-ray crystallography data (which provides static structures) with:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to capture dynamic changes

    • Single-molecule FRET to observe conformational transitions in real-time

  • Functional Reconstitution:

    • Purify individual components (CbiM, CbiN, CbiQ, CbiO)

    • Reconstitute different component combinations

    • Measure ATPase activity and transport rates for each combination

  • Site-directed Mutagenesis:

    • Systematically mutate key residues involved in:

      • Substrate binding

      • Protein-protein interactions

      • ATP hydrolysis coupling

    • Compare transport kinetics of wild-type versus mutant proteins

This approach has proven effective with the CbiMNQO complex, where reconstitution experiments revealed that the substrate-binding subunit CbiM stimulates CbiQO's basal ATPase activity , helping to resolve previously contradictory data.

How can researchers investigate conformational changes in CbiM during the transport cycle?

Investigating the dynamic conformational changes of CbiM requires sophisticated biophysical techniques:

  • Time-resolved Approaches:

    • Temperature-jump spectroscopy coupled with fluorescent probes

    • Stopped-flow spectroscopy to capture millisecond transitions

    • Time-resolved X-ray solution scattering

  • In silico Molecular Dynamics:

    • Simulations based on crystal structures

    • Targeted molecular dynamics to model transition states

    • Binding free energy calculations to validate experimental results

  • Advanced Spectroscopic Methods:

    • Double electron-electron resonance (DEER) spectroscopy

    • Nuclear magnetic resonance (NMR) with specifically labeled residues

    • Vibrational spectroscopy to detect changes in binding sites

These approaches have been valuable in understanding similar transport proteins, revealing that the transport process in CbiMNQO likely requires rotation or toppling of both CbiQ and CbiM, with CbiN functioning to couple conformational changes between these components .

What are the most effective expression systems for producing functional recombinant CbiM?

The choice of expression system significantly impacts the yield and functionality of recombinant CbiM:

Expression SystemAdvantagesDisadvantagesTypical Yield (mg/L)
E. coli BL21(DE3)Low cost, easy manipulationMay form inclusion bodies0.5-2
E. coli C41/C43Better for membrane proteinsModerate yield1-5
Bacillus subtilisGram-positive environmentMore complex genetics0.3-3
Clostridium expression systemNative environment, proper foldingDifficult cultivation, anaerobic0.1-1
Yeast (P. pastoris)Eukaryotic folding machineryGlycosylation differences2-8
Cell-free systemRapid, avoids toxicityExpensive, limited scale0.1-0.5

Research has demonstrated that while E. coli systems offer ease of use, expressing CbiM in its native Clostridium environment or closely related Gram-positive hosts might preserve critical functional characteristics. The choice depends on the specific experimental goals, with structural studies typically requiring higher yields while functional studies prioritize proper folding and activity .

How does ATP binding and hydrolysis in CbiO influence CbiM function?

The relationship between ATP cycling in CbiO and CbiM function represents a critical aspect of the transport mechanism:

  • Conformational Coupling:

    • ATP binding to CbiO induces a closed conformation

    • This conformational change is transmitted through CbiQ to CbiM

    • The structure of CbiO has been determined in its β, γ-methyleneadenosine 5′-triphosphate-bound closed conformation

  • Energy Transduction Pathway:

    • ATP binding energy drives structural rearrangements

    • Hydrolysis and product release reset the system

    • These transitions alter CbiM's substrate-binding affinity, facilitating transport

  • Experimental Evidence:

    • ATPase activity measurements show that CbiM stimulates CbiQO's basal ATPase activity

    • This indicates a functional coupling between substrate binding and ATP hydrolysis

    • Mutations in either component affect the entire transport cycle

Understanding this molecular coupling is essential for developing potential inhibitors or enhancers of cobalt transport, which could have implications for controlling bacterial growth in various environments.

What role does CbiM play in bacterial pathogenesis and antibiotic resistance?

While CbiM's primary function involves cobalt transport, its role extends to bacterial survival and potentially pathogenesis:

  • Cobalt Dependency:

    • Cobalt is essential for vitamin B12 synthesis

    • B12-dependent enzymes are critical for bacterial metabolism

    • Limiting cobalt uptake could restrict bacterial growth

  • Relation to Other Bacterial Defense Systems:

    • Similar to how bacteriocins from Clostridium butyricum show activity against Clostridioides difficile , transport systems may play roles in competitive advantage

    • CbiM expression might be regulated in response to environmental stresses

  • Potential Antimicrobial Targets:

    • Inhibiting CbiM function could represent a novel antibiotic strategy

    • Structure-based drug design targeting the cobalt-binding site or protein-protein interfaces within the CbiMNQO complex

This area represents an emerging research direction, particularly as traditional antibiotics face increasing resistance challenges. Targeting essential nutrient acquisition systems like CbiM offers a potentially valuable alternative therapeutic approach .

What are the optimal conditions for studying CbiM activity in vitro?

Creating the appropriate experimental conditions is crucial for obtaining reliable data on CbiM function:

  • Buffer Composition:

    • pH: 6.5-7.5 (matching physiological conditions of C. cellulovorans)

    • Ionic strength: 100-200 mM NaCl or KCl

    • Reducing agents: 1-5 mM DTT or 2-mercaptoethanol to maintain cysteine residues

    • Detergent: 0.01-0.05% DDM or LDAO for membrane protein stability

  • Temperature and Oxygen Considerations:

    • Temperature: 30-37°C (optimal for C. cellulovorans proteins)

    • Anaerobic conditions preferred (C. cellulovorans is an anaerobic bacterium)

    • Use of oxygen-scavenging systems for assays requiring extended incubation

  • Substrate Considerations:

    • Cobalt concentration: 1-100 μM range (physiologically relevant)

    • Competing metals: Ni2+, Zn2+, Fe2+ to test specificity

    • ATP concentration: 1-5 mM for energizing the transport complex

Protocols should include careful controls to distinguish specific CbiM-mediated transport from non-specific binding or passive diffusion through membranes in reconstituted systems.

How can researchers validate CbiM function in vivo?

Validating CbiM function in living bacterial systems provides essential complementary data to in vitro studies:

  • Genetic Approaches:

    • Gene knockout/knockdown studies (evaluating growth in cobalt-limited media)

    • Complementation assays with wild-type or mutant versions of cbiM

    • Conditional expression systems to titrate CbiM levels

  • Functional Assays:

    • 57Co uptake measurements in whole cells

    • Reporter systems linked to cobalt-dependent processes

    • Metal content analysis using ICP-MS after growth under varying cobalt conditions

  • Localization Studies:

    • Fluorescent protein fusions to track CbiM localization

    • Immunolocalization with anti-CbiM antibodies

    • Fractionation studies similar to those used for CbpA, where immunoblot analyses with specific antisera (anti-HLD1 and anti-HLD34) helped determine cellular location

Through these approaches, researchers can connect molecular mechanisms observed in vitro with physiological functions in the bacterial cell.

How should researchers analyze kinetic data from CbiM transport assays?

Proper analysis of transport kinetics requires appropriate mathematical models and careful consideration of experimental limitations:

  • Kinetic Models:

    • Simple Michaelis-Menten kinetics for initial characterization

    • More complex models incorporating ATP dependence for complete transport cycle

    • Hill equation analysis when examining cooperativity between subunits

  • Data Transformation Approaches:

    • Lineweaver-Burk plots for visualizing kinetic parameters

    • Eadie-Hofstee diagrams to identify multiple binding sites

    • Scatchard analysis for determining binding stoichiometry

  • Statistical Considerations:

    • Minimum of 3-5 biological replicates recommended

    • Appropriate statistical tests based on data distribution

    • Careful evaluation of outliers and their potential significance

When analyzing CbiM function within the complete CbiMNQO complex, researchers should consider that the transport process likely involves coordinated conformational changes across multiple components, as suggested by structural studies of related ECF transporters .

What are the current challenges in structural characterization of the CbiM protein?

Structural biology approaches face several challenges when applied to CbiM:

  • Crystallization Barriers:

    • Membrane proteins like CbiM are notoriously difficult to crystallize

    • Detergent micelles can interfere with crystal packing

    • The dynamic nature of transport proteins creates conformational heterogeneity

  • Cryo-EM Challenges:

    • Relatively small size of individual CbiM (~40-50 kDa) is below ideal size for cryo-EM

    • Contrast issues in detergent environments

    • Capturing transport-relevant conformations

  • Solution NMR Limitations:

    • Size constraints for traditional NMR approaches

    • Complex spectral overlap from membrane-associated regions

    • Challenges in maintaining stable samples during long acquisition times

How might synthetic biology approaches enhance our understanding of CbiM function?

Synthetic biology offers innovative approaches to study and enhance CbiM functionality:

  • Engineered CbiM Variants:

    • Domain swapping with related transporters to identify functional modules

    • Creation of chimeric transporters with altered specificity

    • De novo design of minimal cobalt transporters based on CbiM principles

  • Biosensor Development:

    • CbiM-based whole-cell biosensors for environmental cobalt detection

    • FRET-based sensors incorporating CbiM binding domains

    • Electrochemical sensors utilizing immobilized CbiM

  • Systems Biology Integration:

    • Incorporation of CbiM and the cobalt transport system into genome-scale metabolic models

    • Prediction of cellular responses to cobalt limitation

    • Identification of regulatory networks governing cbiM expression

These approaches could not only advance basic understanding but potentially lead to applications in bioremediation, synthetic biology circuits, and novel antimicrobial strategies targeting essential metal transport systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.