Recombinant Clostridium difficile Cobalt transport protein CbiM (cbiM)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
cbiM; CDR20291_0329; Cobalt transport protein CbiM; Energy-coupling factor transporter probable substrate-capture protein CbiM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-250
Protein Length
Full Length of Mature Protein
Species
Peptoclostridium difficile (strain R20291) (Clostridium difficile)
Target Names
cbiM
Target Protein Sequence
MHIMEGYLPVKWSIAWGVIFIPFFLVGLKSIGKIVKQDPKKKVLLALCGAFVFVLSALKI PSVTGSCSHPTGVGLGAIMFGPSVMFVLGTIVLIFQALLLAHGGITTLGANAFSMAIIGP IISFLIFKALKKKDGNNAMPVFLAAAIGDLATYTVTSIQLALAFPDPSGGVMASAIKFLG IFFMTQIPIAIAEGILTVIVYNLITENGEKSILENNDKGVKANEC
Uniprot No.

Target Background

Function
Component of the energy-coupling factor (ECF) transporter complex CbiMNOQ, involved in cobalt uptake.
Database Links
Protein Families
CbiM family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Clostridium difficile cbiM protein and what is its biological significance?

Clostridium difficile cbiM protein functions as a cobalt transport protein within the bacterial cell membrane. It is a critical component of the CbiMNQO transporter complex, which belongs to the Energy-coupling factor (ECF) transporters, a large family of ATP-binding cassette transporters identified in microorganisms . The biological significance of cbiM lies in its role in micronutrient uptake from the environment, specifically cobalt ions, which are essential cofactors for various enzymatic processes in C. difficile . The protein is derived from Clostridium difficile strain R20291 and has been characterized as having amino acids 26-250 in the recombinant form commonly used in research .

How does cbiM fit into the broader context of Clostridium difficile biology?

Clostridium difficile is a Gram-positive, spore-forming bacterium that belongs to a genus containing approximately 100 species, including both free-living bacteria and significant pathogens . The distinctive bowling pin or bottle-shaped endospores of Clostridium species differentiate them from other bacterial endospores, which are typically ovoid . These bacteria naturally inhabit soils and the intestinal tracts of animals, including humans . Within this biological context, cbiM plays a specialized role in nutrient acquisition, specifically cobalt transport, which supports the bacterium's metabolic functions and potentially its pathogenicity through ensuring adequate micronutrient supply.

What is the structural composition of the CbiMNQO transporter complex?

The CbiMNQO transporter is a modular group-I ECF transporter composed of distinct functional components. The complex includes:

  • CbiM: The membrane substrate-binding component (equivalent to EcfS in group-II ECF transporters)

  • CbiN: A small auxiliary membrane protein unique to group-I ECF transporters

  • CbiQ: The integral membrane scaffold component (equivalent to EcfT)

  • CbiO: The cytoplasmic ATP binding/hydrolysis component (equivalent to EcfA/A')

Structural studies have determined that CbiM lies horizontally along the lipid membrane with its transmembrane helices (SM0-6) roughly parallel to the membrane plane, similar to group-II EcfS proteins . The structure of the CbiMQO complex has been determined in its inward-open conformation, while CbiO has been characterized in its β, γ-methyleneadenosine 5′-triphosphate-bound closed conformation .

What mechanisms govern the conformational changes in CbiM during cobalt transport?

The substrate transport mechanism of the CbiMNQO complex involves sophisticated conformational changes triggered by ATP binding and hydrolysis. Based on structural analyses, the transport process requires the rotation or toppling of both CbiQ and CbiM components . The L1 loop of CbiM serves a substrate-gating function, regulating the entry of cobalt ions into the transport pathway . When ATP binds to CbiO, it induces conformational changes that propagate through the complex, affecting the positioning of CbiQ and subsequently CbiM. CbiN is hypothesized to function in coupling these conformational changes between CbiQ and CbiM, ensuring coordinated movement during the transport cycle . The precise mechanical details of how these conformational changes allow for unidirectional transport of cobalt ions across the membrane represent an important area for continued investigation.

How does the CbiM component stimulate ATPase activity in the transporter complex?

Through reconstitution experiments with different CbiMNQO subunits, researchers have determined that the substrate-binding subunit CbiM stimulates the basal ATPase activity of CbiQO . This stimulation suggests a sophisticated allosteric communication mechanism between the membrane-embedded substrate-binding site and the cytoplasmic ATP hydrolysis domains. The precise molecular pathway of this stimulation involves conformational coupling, where substrate binding at CbiM likely induces structural changes that are propagated to the ATPase components, enhancing their catalytic efficiency. This finding highlights the integrated nature of the transporter complex, where substrate recognition directly influences energy utilization, optimizing the transport process .

What are the functional differences between group-I ECF transporters like CbiMNQO and group-II ECF transporters?

The functional distinction between group-I ECF transporters (like CbiMNQO) and group-II ECF transporters represents an important area of research. While both groups share the common ECF module architecture, several key differences exist:

  • Component Organization: Group-I transporters include an additional small membrane protein (CbiN in CbiMNQO) that is absent in group-II transporters .

  • Substrate Specificity: Group-I transporters typically demonstrate dedicated specificity for particular substrates, with genes encoding all components clustered together in operons specific to the transported substrate .

  • Conformational Mechanics: The transport mechanism in group-I transporters appears to involve rotation or toppling of both the scaffold component (CbiQ) and the substrate-binding component (CbiM), whereas the exact mechanism may differ in group-II transporters .

  • Energetic Coupling: The relationship between ATP hydrolysis and substrate transport may involve different coupling mechanisms between the two groups, with CbiN potentially playing a unique role in group-I transporters .

What expression systems are optimal for producing recombinant C. difficile cbiM protein?

Multiple expression systems have been successfully employed to produce recombinant Clostridium difficile cbiM protein, each with specific advantages depending on research requirements:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid growthMay require optimization of codon usage, potential endotoxin contamination
YeastPost-translational modifications, secretion capabilityLonger production time, complex media requirements
BaculovirusComplex folding support, higher eukaryotic modificationsTechnical complexity, higher cost, longer production time
Mammalian CellMost authentic post-translational modificationsHighest cost, lowest yield, longest production time

The choice of expression system should be guided by the specific research objectives. For structural studies requiring large quantities of protein, E. coli systems may be preferable . For functional studies where proper folding and modifications are critical, insect or mammalian cell systems might be more appropriate despite their higher cost and complexity .

What techniques are most effective for studying CbiM-mediated cobalt transport in vitro?

Investigating CbiM-mediated cobalt transport requires specialized techniques that can monitor ion movement across membranes. The most effective methodologies include:

  • Reconstitution into Proteoliposomes: The CbiMNQO complex can be purified and reconstituted into artificial liposomes, creating a controlled environment to measure transport activity. This approach allows for precise manipulation of lipid composition, ion gradients, and ATP availability .

  • ATPase Activity Assays: Since cobalt transport is coupled to ATP hydrolysis, measuring ATPase activity provides an indirect but quantifiable assessment of transport function. These assays have successfully demonstrated that the substrate-binding subunit CbiM stimulates CbiQO's basal ATPase activity .

  • Radioisotope Flux Measurements: Using radioactive cobalt isotopes (⁶⁰Co) to track ion movement across membranes provides direct evidence of transport activity and kinetics.

  • Fluorescent Cobalt Sensors: Developing fluorescent sensors that respond to cobalt concentration changes can allow real-time, non-invasive monitoring of transport in reconstituted systems.

  • Structural Analysis with Conformational Locking: By trapping the transporter in different conformational states through ATP analogs or mutations, researchers can analyze the structural changes associated with different steps of the transport cycle .

How can researchers effectively analyze the structure-function relationship in CbiM protein?

Analyzing the structure-function relationship in CbiM protein requires an integrated approach combining structural determination, mutagenesis, and functional assays:

  • Targeted Mutagenesis Strategy:

    • Focus on the L1 loop region identified as having substrate-gating function

    • Create alanine scanning mutations across transmembrane helices

    • Modify residues at the CbiM-CbiQ interface to probe conformational coupling

  • Structural Analysis Pipeline:

    • X-ray crystallography of isolated CbiM and complexes with other subunits

    • Cryo-electron microscopy for capturing different conformational states

    • Molecular dynamics simulations to predict conformational changes during transport cycle

  • Functional Correlation Methods:

    • Measure transport rates of wild-type versus mutant proteins

    • Assess ATPase stimulation capabilities of mutant CbiM variants

    • Monitor conformational changes using fluorescence resonance energy transfer (FRET)

This integrated approach allows researchers to connect specific structural elements of CbiM to their functional roles in cobalt recognition, binding, and translocation across the membrane.

How should researchers design experiments to investigate the interaction between CbiM and other components of the transporter complex?

Designing experiments to study the interactions between CbiM and other components of the CbiMNQO transporter requires careful consideration of multiple factors:

  • Protein-Protein Interaction Analysis:

    • Co-immunoprecipitation with tagged variants of complex components

    • Surface plasmon resonance to measure binding affinities between isolated components

    • Chemical cross-linking followed by mass spectrometry to identify interaction interfaces

    • Bacterial two-hybrid systems for in vivo validation of interactions

  • Functional Reconstitution Approach:

    • Systematically omit individual components (CbiM, CbiN, CbiQ, CbiO) to assess their necessity

    • Create chimeric proteins by swapping domains between related transporters

    • Express components with fluorescent tags to monitor assembly in living cells

  • Structural Investigation Strategy:

    • Use deletion constructs to identify minimal functional units

    • Employ disulfide cross-linking to trap specific interaction states

    • Perform hydrogen-deuterium exchange mass spectrometry to identify dynamic interaction regions

  • Data Integration Framework:

    • Correlate interaction data with transport activity measurements

    • Develop computational models of the complete complex

    • Use molecular dynamics simulations to predict interaction effects on conformational changes

What considerations are important when investigating the substrate specificity of the CbiM protein?

When investigating substrate specificity of CbiM protein, researchers should consider:

  • Competitive Binding Assays:

    • Test cobalt against other divalent metal ions (nickel, zinc, iron, manganese)

    • Determine IC50 values for each potential competitive substrate

    • Analyze binding under different pH and temperature conditions

  • Structural Determinants of Specificity:

    • Identify metal coordination sites through mutagenesis of predicted liganding residues

    • Compare sequence conservation of binding sites across different CbiM homologs

    • Examine structural changes upon binding different metal ions

  • Transport Kinetics Analysis:

    • Measure transport rates with different metal ions

    • Determine Michaelis-Menten parameters (Km, Vmax) for each potential substrate

    • Analyze whether transport of different metals requires the same or different coupling mechanisms

  • Physiological Relevance Assessment:

    • Investigate growth phenotypes of C. difficile strains with CbiM mutations in media with different metal availability

    • Examine the impact of metal availability on virulence factor production

    • Correlate in vitro specificity with in vivo function

This structured approach allows researchers to comprehensively characterize both the molecular basis and physiological significance of CbiM's substrate specificity .

What are the promising avenues for developing inhibitors targeting the CbiMNQO transport system?

Development of inhibitors targeting the CbiMNQO transport system represents a promising research direction with potential therapeutic applications. Several approaches warrant exploration:

  • Structure-Based Drug Design:

    • Utilize the determined structure of the CbiMQO complex in its inward-open conformation

    • Target the substrate-binding site in CbiM to block cobalt entry

    • Design molecules that interfere with the conformational changes necessary for transport

    • Develop compounds that disrupt the interfaces between subunits, particularly CbiM-CbiQ interactions

  • Allosteric Inhibitor Development:

    • Target the L1 loop of CbiM to interfere with its substrate-gating function

    • Develop compounds that lock the transporter in a single conformational state

    • Create molecules that prevent ATP-induced conformational changes

  • Competitive Substrate Analogs:

    • Design cobalt mimetics that bind but cannot be transported

    • Develop metal chelators that specifically deplete available cobalt

    • Create prodrugs that release inhibitory compounds in response to C. difficile-specific enzymes

This research could potentially lead to novel antimicrobial strategies targeting C. difficile infections by disrupting essential cobalt acquisition pathways.

How might comparative analysis of CbiM across different pathogens inform our understanding of bacterial metal transport systems?

Comparative analysis of CbiM across different bacterial pathogens offers valuable insights into the evolution and specialization of metal transport systems:

  • Evolutionary Conservation Analysis:

    • Compare sequence conservation of CbiM across diverse bacterial species

    • Identify universally conserved residues likely critical for fundamental transport functions

    • Examine lineage-specific adaptations that might reflect niche-specific metal acquisition strategies

  • Host-Pathogen Interface Considerations:

    • Analyze CbiM variations in pathogens facing different host nutritional immunity mechanisms

    • Compare CbiM structures from pathogens occupying different host niches (gut, respiratory tract, etc.)

    • Identify potential signatures of selective pressure from host metal sequestration

  • Functional Divergence Exploration:

    • Test whether CbiM proteins from different species maintain strict cobalt specificity or have evolved to transport additional metals

    • Examine whether transport kinetics vary in ways that correlate with pathogen lifestyle

This comparative approach would not only enhance our fundamental understanding of bacterial metal transport but could also reveal common vulnerabilities across different pathogens that might be exploited for broad-spectrum therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.